DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and capza2

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001017254.1 Gene:capza2 / 550008 XenbaseID:XB-GENE-489168 Length:286 Species:Xenopus tropicalis


Alignment Length:225 Identity:38/225 - (16%)
Similarity:70/225 - (31%) Gaps:73/225 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 RLEIKNQEERKASGSSGHEPNDLLPMCPNRLESCVRQLL-----DDGISPFPYKVAKSMDPYMYR 311
            ||.:.|....:...:......:|....|.:::....|:|     |.|...|       :||....
 Frog    37 RLLLNNDNLLREGAAHAFAQYNLDQFTPVKIDGYDEQVLITEHGDLGNGRF-------LDPKSKI 94

  Fly   312 NIEFDCWNDMRKEA---------KLYNVYINDYNFKVGAKCKVELPNETEMYTCHVQNISKDKNY 367
            :.:||   .:||||         .....:.|..:..|.:..|...||                ..
 Frog    95 SFKFD---HLRKEASDPRPSDGENAIESWRNTVDTAVRSYVKEHYPN----------------GV 140

  Fly   368 CHVFVERI-GKEIVVPYESLHPLPPDEYRPWSLPFRYHRQMPRLPLPKYAGKANKSSKWK----- 426
            |.|:.:.| |::.::.....|......:  |:..:|                    |:||     
 Frog   141 CTVYGKTIDGQQTIIACIESHQFQAKNF--WNGRWR--------------------SEWKFTITP 183

  Fly   427 -KNKLFEM----DQYFEHSKCDLMPYMPVD 451
             ..|:|.:    ..|:|.....|:.:..::
 Frog   184 STTKVFGILKIQVHYYEDGNVQLVSHKDIE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090
TUDOR 335..392 CDD:197660 9/57 (16%)
TAF12 <446..>564 CDD:304643 0/6 (0%)
capza2NP_001017254.1 F-actin_cap_A 17..283 CDD:366546 38/225 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.