DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and Otud5

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001277465.1 Gene:Otud5 / 54644 MGIID:1859615 Length:567 Species:Mus musculus


Alignment Length:213 Identity:51/213 - (23%)
Similarity:94/213 - (44%) Gaps:30/213 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QAPDP---------YDQYL-ESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMTL 69
            :|.||         :::.| :.:|...|....|.:.|||.:|:|:|..|.:|..:|..|:.::..
Mouse   189 EAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMK 253

  Fly    70 KRRIFEKEIPGDFDSYMQDMSKPKTYGTMTELRAMSCLYRRNVILY----EPYNMGTSVVFNRRY 130
            ....|...:..||.:|:....|...:|...|::||:.:|.|.|.:|    ||.|  |....::..
Mouse   254 NADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPIN--TFHGIHQNE 316

  Fly   131 AENFRVFFNNENHFDSVYDVEYIERAAICQSI---AFK------LLYQKLFKLPDVSFAVEIMLH 186
            .|..||.::...|::||.:.   .:|.|...:   :||      .|.:...|..:.|:..:.||.
Mouse   317 DEPIRVSYHRNIHYNSVVNP---NKATIGVGLGLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLE 378

  Fly   187 --PHTFNWDRFNVEFDDK 202
              ....:|:..|...:::
Mouse   379 DKKRATDWEATNEAIEEQ 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 23/77 (30%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
Otud5NP_001277465.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..175
Cys-loop. /evidence=ECO:0000250 218..224 1/5 (20%)
OTU 221..332 CDD:388712 32/112 (29%)
Variable-loop. /evidence=ECO:0000250 273..283 2/9 (22%)
His-loop. /evidence=ECO:0000250 324..329 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..499
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4984
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.