DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and Otud3

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:XP_038966554.1 Gene:Otud3 / 500572 RGDID:1560468 Length:423 Species:Rattus norvegicus


Alignment Length:337 Identity:62/337 - (18%)
Similarity:112/337 - (33%) Gaps:111/337 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QRPITSGSRQAPDP-----------YDQYLESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEI 59
            :|.:....|..|:|           :...|::.||..:....|.:.|||.:.:|:......|.:.
  Rat    30 RRALAKERRNRPEPGSSGCEEEFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKH 94

  Fly    60 RLECVRFMTLKRRIFEKEIPGD--FDSYMQDMSKPKTYGTMTELRAMSCLYRRNVILY------- 115
            |.|.|.:|..:|..||..:..|  |:.::..::||.|:.....:.|.:..::.||:::       
  Rat    95 RQETVDYMIRQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIVAFARNHQLNVVIHQLNAPLW 159

  Fly   116 ------------------------EPYN-----MGTSVVFNRRYAENFRVFFNNENHFDSVYDVE 151
                                    ||..     .||    ::..|....:.:....|:|||..:.
  Rat   160 QIISKCLSFRLQQTWVCFWVSHQKEPVQSRGQIRGT----DKSSARELHIAYRYGEHYDSVRRIN 220

  Fly   152 YIERAAICQSIAFKLLYQKLFKLPDVSFAVEIMLHPHTFNWDRFNVEFDDKGYMVRIHCTDGRVF 216
            ....|.......|::|:|                       ||.|.:...|        |.|...
  Rat   221 DNSEAPAHLLTDFQMLHQ-----------------------DRTNKKEKMK--------TQGDSL 254

  Fly   217 KLDLPG------------DTNCILENYKLCNFHS----------TNGNQSINARK----GGRLEI 255
            :.|:..            |:|.|::|.: ...|:          .|...|.:|.|    |.|::.
  Rat   255 RDDMEDAVQKAGSATGCTDSNLIVQNLE-AESHTIEPSVTALLQMNQGTSKDAEKSLEPGDRVKQ 318

  Fly   256 KNQEERKASGSS 267
            :.....:|.|.|
  Rat   319 RGPSCEEAGGGS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 21/79 (27%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
Otud3XP_038966554.1 OTU 70..>156 CDD:418725 21/85 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.