DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and Otud1

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:XP_574086.3 Gene:Otud1 / 498803 RGDID:1563344 Length:455 Species:Rattus norvegicus


Alignment Length:140 Identity:35/140 - (25%)
Similarity:62/140 - (44%) Gaps:8/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DQYLESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGDFDSY 85
            |:||..|..||.|...|.:.|:|.:::.:|..|.||.|:|.:.|.::......|...|.||...:
  Rat   275 DKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEF 339

  Fly    86 MQDMSKPKTYGTMTELRAMSCLYRRNVIL-----YEPYNMGTSVVF---NRRYAENFRVFFNNEN 142
            :...::...:....||.||..:...|:.|     .|...:.|.|.:   ......:..:.:.:..
  Rat   340 IIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMVHYLGPEDSLRPSIWLSWLSNG 404

  Fly   143 HFDSVYDVEY 152
            |:|:|:|..|
  Rat   405 HYDAVFDHSY 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 20/82 (24%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
Otud1XP_574086.3 OTU 289..406 CDD:280496 23/116 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338858
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.