DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and otud6b

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001011269.1 Gene:otud6b / 496720 XenbaseID:XB-GENE-985119 Length:294 Species:Xenopus tropicalis


Alignment Length:171 Identity:34/171 - (19%)
Similarity:62/171 - (36%) Gaps:51/171 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SGSRQAPDPYDQYLESRGLYR---------KHTARDASSLFRVIAEQMYD--TQMLHYEIRLECV 64
            ||:|        :|||:.|.|         :....|...::|.|..|:.:  ..:....:|.:..
 Frog   131 SGAR--------HLESQKLARILAERELQIRQIPSDGHCMYRAIEHQLRERGNDLTVANLRSQTA 187

  Fly    65 RFMTLKRRIFEKEIP-------GD------FDSYMQDMSKPKTYGTMTELRAMSCLYR------- 109
            .:|   :...|..:|       ||      |..|..|:.....:|...||||:|.:.:       
 Frog   188 DYM---QNHAEDFLPFLTNSSTGDMYTQEEFLKYCTDIVNTPAWGGQLELRALSHILKTAIEVIQ 249

  Fly   110 ---RNVILYEPYNMGTSVVFNRRYAENFRVFFNNENHFDSV 147
               ..:::.|.|:.....:...|:|      :....|::||
 Frog   250 AESSPIVIGEEYSSKAITLVYMRHA------YGLGEHYNSV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 19/102 (19%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
otud6bNP_001011269.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
COG5539 4..285 CDD:227826 34/171 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..120
Cys-loop. /evidence=ECO:0000250 155..161 1/5 (20%)
OTU 156..281 CDD:280496 23/133 (17%)
Variable-loop. /evidence=ECO:0000250 222..232 1/9 (11%)
His-loop. /evidence=ECO:0000250 270..280 2/15 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.