DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and otud5b

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001314694.1 Gene:otud5b / 445146 ZFINID:ZDB-GENE-040801-50 Length:537 Species:Danio rerio


Alignment Length:216 Identity:53/216 - (24%)
Similarity:102/216 - (47%) Gaps:23/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MQVQRPITSGSRQAPDPYDQYL-ESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRF 66
            :|:..|.|  :.|..:.:::.| |.:|...|....|.:.|||.:|:|:|..|.:|..||.:|:.:
Zfish   169 LQLVDPAT--AEQQEEWFEKALREKKGFEIKKMKEDGACLFRAVADQIYGDQDMHDVIRKQCMDY 231

  Fly    67 MTLKRRIFEKEIPGDFDSYMQDMSKPKTYGTMTELRAMSCLYRRNVILY----EPYNMGTSVVFN 127
            :|.....|...:..||.:|:....|...:|...|::||:.::.|.|.:|    ||.|:...:..|
Zfish   232 LTKNADYFSSYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMFNRPVEVYQYGIEPINIFHGIQEN 296

  Fly   128 RRYAENFRVFFNNENHFDSVYDVEYIERAAICQSI---AFK------LLYQKLFKLPDVSFAVEI 183
            .  .:..||.::...|::||.: .|  :|::...:   :||      .|.:...|..:.|:..:.
Zfish   297 N--DDPIRVSYHKNIHYNSVVN-PY--KASVGVGLGLPSFKPGFADQCLMKNAIKTSEESWIEQQ 356

  Fly   184 MLH--PHTFNWDRFNVEFDDK 202
            ||.  ....:|:..|...:::
Zfish   357 MLEDKKRATDWEATNEAIEEQ 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 24/77 (31%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
otud5bNP_001314694.1 OTU 202..311 CDD:303090 31/110 (28%)
MSA-2c <349..474 CDD:289042 5/29 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.