DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and zgc:92907

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001002460.2 Gene:zgc:92907 / 436733 ZFINID:ZDB-GENE-040718-161 Length:164 Species:Danio rerio


Alignment Length:189 Identity:32/189 - (16%)
Similarity:55/189 - (29%) Gaps:74/189 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   670 VVIGATE-----DNLTAVESTPPPSPEVANATEQSPLEKSAYAKRNLNSVKVRGKRPEQLQDIKD 729
            |.:|.|.     |.:|:.||.                  .|..:|....|.::            
Zfish     6 VTVGTTSFDDLIDTVTSDESV------------------KALIQRGFTGVNLQ------------ 40

  Fly   730 SLGPAAFLPTPTPSPSSNGSQFSFYTTPSP---HHHLITPPRLLQPPPPPPIFYHKAGPPQLGGA 791
             :|..:.:|.|...|......|.|..:.:.   |..|:                       :..|
Zfish    41 -VGRGSVVPDPESCPGLKLQVFRFKDSIAEDMRHSDLV-----------------------ISHA 81

  Fly   792 AQGQTPYAWGMPAP--VVSPYEVINNYNMDPSAQPQQQQ----------PATLQPAPLS 838
            ..|....|.|...|  ||...::::|:.::.:.|.|...          |.||:...|:
Zfish    82 GAGSCLEALGANKPLLVVVNDKLMDNHQLELARQLQADSHLIYCTCSTLPQTLREMDLT 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
zgc:92907NP_001002460.2 Glycosyltransferase_GTB_type 3..158 CDD:299143 32/189 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.