DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and otud3

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_998087.1 Gene:otud3 / 405858 ZFINID:ZDB-GENE-040426-2509 Length:357 Species:Danio rerio


Alignment Length:137 Identity:31/137 - (22%)
Similarity:60/137 - (43%) Gaps:15/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YDQYLESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGD--F 82
            :...|::.||..:....|.:.|||.:.:|:......|..:|.|.|.:|...|..||..:..|  |
Zfish    50 FSNQLQALGLKLREVPGDGNCLFRALGDQLEGHSRGHLHLRQETVHYMRTHRNDFEPFVEDDVPF 114

  Fly    83 DSYMQDMSKPKTYGTMTELRAMS-------CLYRRNVILYEPYNMGTSVVFNRRYAENFRVFFNN 140
            :.::.::|:..|:.....:.|.:       .:::.|..|:| .| ||    .:.......:.:..
Zfish   115 EKHLTNLSQQGTFAGNDAIVAFARSQQLKVVIHQLNAPLWE-IN-GT----EKPSCRELHIAYRY 173

  Fly   141 ENHFDSV 147
            .:|:|||
Zfish   174 GDHYDSV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 19/86 (22%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
otud3NP_998087.1 OTU 65..>151 CDD:303090 18/85 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.