DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and CG7857

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster


Alignment Length:100 Identity:25/100 - (25%)
Similarity:42/100 - (42%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LESRGLYRKHTARDASSLFRVIAEQMYDTQMLHY---EIRLECVRFM-----TLKRRIFEKEIPG 80
            |..|.|...:...|...|::.|..|:....:..:   |:|.|...::     :|...:...| .|
  Fly   167 LSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPE-TG 230

  Fly    81 D------FDSYMQDMSKPKTYGTMTELRAMSCLYR 109
            |      |:.|..|::|...:|...||:|:|.|.|
  Fly   231 DILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 21/86 (24%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
CG7857NP_648769.2 COG5539 17..307 CDD:227826 24/99 (24%)
OTU 178..305 CDD:280496 21/88 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.