DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and Otud5

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:XP_006256799.1 Gene:Otud5 / 363452 RGDID:1563027 Length:640 Species:Rattus norvegicus


Alignment Length:213 Identity:51/213 - (23%)
Similarity:94/213 - (44%) Gaps:30/213 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QAPDP---------YDQYL-ESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMTL 69
            :|.||         :::.| :.:|...|....|.:.|||.:|:|:|..|.:|..:|..|:.::..
  Rat   262 EAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMK 326

  Fly    70 KRRIFEKEIPGDFDSYMQDMSKPKTYGTMTELRAMSCLYRRNVILY----EPYNMGTSVVFNRRY 130
            ....|...:..||.:|:....|...:|...|::||:.:|.|.|.:|    ||.|  |....::..
  Rat   327 NADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPIN--TFHGIHQNE 389

  Fly   131 AENFRVFFNNENHFDSVYDVEYIERAAICQSI---AFK------LLYQKLFKLPDVSFAVEIMLH 186
            .|..||.::...|::||.:.   .:|.|...:   :||      .|.:...|..:.|:..:.||.
  Rat   390 DEPIRVSYHRNIHYNSVVNP---NKATIGVGLGLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLE 451

  Fly   187 --PHTFNWDRFNVEFDDK 202
              ....:|:..|...:::
  Rat   452 DKKRATDWEATNEAIEEQ 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 23/77 (30%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
Otud5XP_006256799.1 OTU 294..403 CDD:303090 31/110 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.