DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and Otud6a

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:XP_228584.1 Gene:Otud6a / 302426 RGDID:1560855 Length:290 Species:Rattus norvegicus


Alignment Length:163 Identity:34/163 - (20%)
Similarity:64/163 - (39%) Gaps:37/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RQAPDPYDQYLESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMT---LKRRI-- 73
            |:..:.....|.::.|..|....|...::|.|.:|      |.:.:.:|.:|:.|   :::.|  
  Rat   127 REEEEKVAAILGAKNLEMKTIPADGHCMYRAIQDQ------LVFSVTIESLRYRTAYYMRKHIDD 185

  Fly    74 ----FEKEIPG------DFDSYMQDMSKPKTYGTMTELRAMSCLYRRN----------VILYEPY 118
                |.:...|      ||..|..|:....::|...||||:|.:.:..          :::.|.|
  Rat   186 FLPFFTEPEAGNFYTREDFLRYCDDIVHKASWGGQLELRALSHVLQTPIEVVQANSPIIVIGEEY 250

  Fly   119 NMGTSVVFNRRYAENFRVFFNNENHFDSVYDVE 151
            ......:....||.:|      ..|::||..:|
  Rat   251 TRKPLTLVYLHYACDF------GEHYNSVKPIE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 21/102 (21%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
Otud6aXP_228584.1 COG5539 5..272 CDD:227826 31/156 (20%)
OTU 148..270 CDD:396767 26/133 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.