DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and Otud6b

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:XP_038965351.1 Gene:Otud6b / 297911 RGDID:1310024 Length:333 Species:Rattus norvegicus


Alignment Length:160 Identity:34/160 - (21%)
Similarity:61/160 - (38%) Gaps:29/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SGSRQ-APDPYDQYLESRGLYRKHTARDASSLFRVIAEQM--YDTQMLHYEIRLECVRFMTLKRR 72
            ||:|. ..:...|.|.:|.|..||...|...::..:.:|:  .|:.:....:|.:...:|.....
  Rat   159 SGARHLESEKLAQILAARELEIKHIPSDGHCMYGALEDQLREQDSALTVATLRRQTAEYMQSHSD 223

  Fly    73 IF----------EKEIPGDFDSYMQDMSKPKTYGTMTELRAMSCLYRR----------NVILYEP 117
            .|          :...|.:|..|..|:.....:|...||||:|.:.:.          .:|:.|.
  Rat   224 DFLPFLTNPNTGDMYTPEEFGKYCDDIVNTAAWGGQLELRALSHILKTPIEILQADAPPIIVGEE 288

  Fly   118 YNMGTSVVFNRRYAENFRVFFNNENHFDSV 147
            |.....|:...|:|      :....|::||
  Rat   289 YPRNPLVLVYMRHA------YGLGEHYNSV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 17/99 (17%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
Otud6bXP_038965351.1 COG5539 43..311 CDD:227826 32/157 (20%)
OTU 184..309 CDD:396767 22/130 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.