DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and alg13

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_593269.1 Gene:alg13 / 2543352 PomBaseID:SPAC56E4.02c Length:162 Species:Schizosaccharomyces pombe


Alignment Length:104 Identity:20/104 - (19%)
Similarity:34/104 - (32%) Gaps:25/104 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GSRQAPDPYDQYLESRGLYRKH--------TARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMT 68
            |...||: .:.|:....:...|        |.|....|..|..|.:.|...:....:|..:.::.
pombe    60 GFDYAPE-IESYIHDASIVISHAGAGSILQTLRSGKRLLVVPNESLMDNHQVELATKLASMNYLV 123

  Fly    69 -------------LKRRI---FEKEIPGDFDSYMQDMSK 91
                         |..:|   |.|.....|...|||:::
pombe   124 TCSTSNLVEGLEELYPKILTPFPKSDCSTFQKVMQDVAR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 13/71 (18%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
alg13NP_593269.1 COG5017 2..162 CDD:227350 20/102 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.