DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and OTUD3

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:XP_005245849.1 Gene:OTUD3 / 23252 HGNCID:29038 Length:465 Species:Homo sapiens


Alignment Length:174 Identity:38/174 - (21%)
Similarity:75/174 - (43%) Gaps:16/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPITSGSRQAPDPYDQY---LESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMT 68
            ||.:.|.....:.:..:   |::.||..:....|.:.|||.:.:|:......|.:.|.|.|.:|.
Human   115 RPESGGGGGCEEEFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMI 179

  Fly    69 LKRRIFEKEIPGD--FDSYMQDMSKPKTYGTMTELRAMSCLYRRNVILYEPYN------MGTSVV 125
            .:|..||..:..|  |:.::..::||.|:.....:.|.:..::.||:::: .|      .||   
Human   180 KQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIVAFARNHQLNVVIHQ-LNAPLWQIRGT--- 240

  Fly   126 FNRRYAENFRVFFNNENHFDSVYDVEYIERAAICQSIAFKLLYQ 169
             .:.......:.:....|:|||..:.....|.......|::|:|
Human   241 -EKSSVRELHIAYRYGEHYDSVRRINDNSEAPAHLQTDFQMLHQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 21/79 (27%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
OTUD3XP_005245849.1 OTU 146..>232 CDD:303090 21/86 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.