DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and OTUD1

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001138845.1 Gene:OTUD1 / 220213 HGNCID:27346 Length:481 Species:Homo sapiens


Alignment Length:140 Identity:34/140 - (24%)
Similarity:62/140 - (44%) Gaps:8/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DQYLESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGDFDSY 85
            |:||..|..||.|...|.:.|:|.:::.:|..|.||.|:|.:.|.::......|...|.||...:
Human   301 DKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEF 365

  Fly    86 MQDMSKPKTYGTMTELRAMSCLYRRNVIL-----YEPYNMGTSVVF---NRRYAENFRVFFNNEN 142
            :...::...:....||.||..:...|:.|     .|...:.|.:.:   ......:..:.:.:..
Human   366 IIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNG 430

  Fly   143 HFDSVYDVEY 152
            |:|:|:|..|
Human   431 HYDAVFDHSY 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 20/82 (24%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
OTUD1NP_001138845.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..282
Cys-loop 314..320 1/5 (20%)
OTU 315..432 CDD:280496 22/116 (19%)
His-loop 369..379 0/9 (0%)
Variable-loop 426..431 0/4 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145156
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4984
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.