DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and otub-4

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_500333.3 Gene:otub-4 / 177104 WormBaseID:WBGene00015249 Length:436 Species:Caenorhabditis elegans


Alignment Length:153 Identity:44/153 - (28%)
Similarity:68/153 - (44%) Gaps:40/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PITSGSRQAPDPY-------------------DQY-----------------LESRGLYRKHTAR 36
            ||.|.|...|.|.                   |:|                 |.:|||..|....
 Worm    78 PIPSSSPVLPPPQPEIEPNRSQSPGNADYNSDDEYEMQNIRDDEIETEFSNRLAARGLIIKEMVG 142

  Fly    37 DASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGDFDSYMQDMSKPKTYGTMTEL 101
            |.:.:||.||||:|..|.:|.:||..|:.:|:..|..|::.|..:|::|:|...:...:|...||
 Worm   143 DGACMFRSIAEQIYGDQEMHGQIRRLCMDYMSNNRDHFKEFITENFENYIQRKREENVHGNHVEL 207

  Fly   102 RAMSCLYRRNVILY----EPYNM 120
            :|:|.::.|.|.:|    ||.|:
 Worm   208 QAISEMFARPVEVYQYSDEPINV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 27/77 (35%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
otub-4NP_500333.3 OTU 142..277 CDD:388712 31/89 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.