DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and plcxd2

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:XP_002940157.1 Gene:plcxd2 / 100496710 XenbaseID:XB-GENE-5832516 Length:315 Species:Xenopus tropicalis


Alignment Length:163 Identity:29/163 - (17%)
Similarity:69/163 - (42%) Gaps:33/163 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SLFRVIAEQMYDTQMLHYEIRLEC-VRFMTLKRRIFEK-EIPGDFDSYMQDMSKPKTYGTMTELR 102
            ||.:.:.::...||.|.::.:||. :|:..|  |:..| |..|....::..:...|.:..:.|:.
 Frog    59 SLVKRLMKKWSVTQNLTFKEQLESGIRYFDL--RVSSKPEEAGKEIYFIHGLYGIKVWDGLEEIN 121

  Fly   103 AMSCLYRRNVILYEPYNMGTSVVFNRRYAENFRVFFNNENHFDSVYDVEYIERAAIC-----QSI 162
            .....:.:.::|.:         ||..||      .::|:|...|..::.:..:.:|     ::|
 Frog   122 KFLTQHNKEIVLLD---------FNHFYA------MDHEHHLYLVNMMQEVFGSKLCTADCVENI 171

  Fly   163 AFKLLYQKLFKLPDVSFAVEIMLHPHTFNWDRF 195
            ..:.|:.|.:         ::::..|...|:.:
 Frog   172 TLQYLWGKKY---------QVLIFYHYNLWNEY 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 15/76 (20%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
plcxd2XP_002940157.1 PI-PLCXD1c 13..303 CDD:176555 29/163 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.