powered by:
Protein Alignment otu and snca
DIOPT Version :9
Sequence 1: | NP_511089.2 |
Gene: | otu / 31789 |
FlyBaseID: | FBgn0003023 |
Length: | 853 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001090876.1 |
Gene: | snca / 100038302 |
XenbaseID: | XB-GENE-1014191 |
Length: | 140 |
Species: | Xenopus tropicalis |
Alignment Length: | 43 |
Identity: | 11/43 - (25%) |
Similarity: | 20/43 - (46%) |
Gaps: | 3/43 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 491 KQHQRTKASRVQPQNSSSSQNQEVSGSAA---PPPTQYMNYVP 530
|:.|:.::...|.....:|:|..|:.... ||..:|.:|.|
Frog 96 KKDQKNESGFGQEGTVENSENMPVNPDETYEMPPEEEYQDYDP 138
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
128 |
1.000 |
Domainoid score |
I5243 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
203 |
1.000 |
Inparanoid score |
I3641 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm9555 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1801 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.960 |
|
Return to query results.
Submit another query.