DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and snca

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001090876.1 Gene:snca / 100038302 XenbaseID:XB-GENE-1014191 Length:140 Species:Xenopus tropicalis


Alignment Length:43 Identity:11/43 - (25%)
Similarity:20/43 - (46%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 KQHQRTKASRVQPQNSSSSQNQEVSGSAA---PPPTQYMNYVP 530
            |:.|:.::...|.....:|:|..|:....   ||..:|.:|.|
 Frog    96 KKDQKNESGFGQEGTVENSENMPVNPDETYEMPPEEEYQDYDP 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643 11/43 (26%)
sncaNP_001090876.1 Synuclein 1..131 CDD:396110 8/34 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5243
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I3641
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9555
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1801
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.