DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)72Dp and ggh

DIOPT Version :9

Sequence 1:NP_730119.1 Gene:l(3)72Dp / 317887 FlyBaseID:FBgn0263607 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001025598.1 Gene:ggh / 594986 XenbaseID:XB-GENE-944415 Length:315 Species:Xenopus tropicalis


Alignment Length:322 Identity:116/322 - (36%)
Similarity:182/322 - (56%) Gaps:26/322 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIFIGALLAASEAGI--------SSPIIGVLTQEVYVDGLISRHFDN----KTSYIAASYVKYL 60
            ||:.:|.|:.:..:.:        ..||||:|.||.        ||:.    ..|||||||||.:
 Frog     6 LLLLLGTLVLSQGSSLYNSPLTANDRPIIGILAQET--------HFEELQMFGKSYIAASYVKTI 62

  Fly    61 EGAGARVVPIWIGRNRSYYDDLMRKINGVLLPGGATWFNQSNGYADAGEHLIHLAIELNDQGVFM 125
            |.|||||:||.:......|:.:...|||:|.||||....:|. ||...:...:.|:|.||:|.:.
 Frog    63 ESAGARVIPILLNLAEEEYEKIFNSINGILFPGGAVDLVKSE-YARVAKIFYNQALEANDKGDYF 126

  Fly   126 PVWGTCLGMELLVYKLANETEHRINCEATGMAVPMEFKEDYKKSRLFASITDDVVDTMVKENVTY 190
            |:||||||.|.|.|..:.|....:. |...:::|:.|..:...|:||..:..::...:..:.:|.
 Frog   127 PIWGTCLGFEELTYLSSGEILLTLT-ETEDISLPLNFSSNALNSKLFKHLPKELYTALSSKPITA 190

  Fly   191 HWHQFCYTEKDF-ERDLLNETWRVMSLNHDWNGVEFISTVEHIKYPFYGVQFHPEKPLYEFTKTS 254
            ::|.:..:.::| :.:.|::.:.|::.|.| ..||||||.|...||.||||:||||..:|:.|||
 Frog   191 NFHYWSLSMQNFTKNEKLSKFYNVLTTNSD-GSVEFISTFEAYDYPIYGVQWHPEKNPFEWKKTS 254

  Fly   255 -IPHTAAAVLSGQFFADFFVSEARESNQSFSNATEQARTLIYNYKPEYTSILGSSYIQQYLF 315
             |.|::.||.:..:.|:|||:|||:|:..|:...::.:.|||||.|:.|..: |.:.|.|.|
 Frog   255 NISHSSEAVKTAFYMAEFFVNEARKSSHHFTKEEDETKVLIYNYFPKNTGNI-SVFQQMYFF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)72DpNP_730119.1 Peptidase_C26 26..244 CDD:285023 81/222 (36%)
GATase1_Glutamyl_Hydrolase 28..303 CDD:153218 105/280 (38%)
gghNP_001025598.1 Peptidase_C26 32..244 CDD:285023 81/222 (36%)
GATase1_Glutamyl_Hydrolase 34..304 CDD:153218 105/280 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I4468
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2881
Inparanoid 1 1.050 203 1.000 Inparanoid score I3642
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539287at33208
OrthoFinder 1 1.000 - - FOG0002965
OrthoInspector 1 1.000 - - mtm9470
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5199
SonicParanoid 1 1.000 - - X1961
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.