DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)72Dp and l(3)72Dr

DIOPT Version :9

Sequence 1:NP_730119.1 Gene:l(3)72Dp / 317887 FlyBaseID:FBgn0263607 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_730120.1 Gene:l(3)72Dr / 39778 FlyBaseID:FBgn0263608 Length:345 Species:Drosophila melanogaster


Alignment Length:330 Identity:117/330 - (35%)
Similarity:185/330 - (56%) Gaps:31/330 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PIIGVLTQEVYVDGLISRHFDNK-TSYIAASYVKYLEGAGARVVPIWIGRNRSYYDDLMRKINGV 89
            |.:||:..::...  :.::|... .||:||||||:||.:||.||||||||.|:||..:|.::||:
  Fly    16 PTVGVMCIDIATQ--LQQNFSGAYHSYLAASYVKFLEASGAHVVPIWIGRERAYYALMMSQLNGI 78

  Fly    90 LLPGGATWFNQSNGYAD---------AGEHLIHLAIE-------LNDQGVFMPVWGTCLGMELLV 138
            ||||||.:.::::..|:         :.|.:..||:|       |:|:|.:.||||||||.:|::
  Fly    79 LLPGGAVFIDEADRQANPDVTSDCVRSAELIYQLAMERNMRAKKLDDRGAYFPVWGTCLGFQLIL 143

  Fly   139 YKLANETEHRINCEATGMAVPMEFKEDYKKSRLFASITDDVVDTMVKENVTYHWHQFCYTEKDFE 203
            ...|.....||.|:....|:|:...:||::|:|..|:...|.|.|.|.....|.|::|.|::..|
  Fly   144 IHAAEAPNVRIACQPMREAMPVTLTDDYQQSQLLGSLPKSVADEMEKHPFACHQHRYCITKESLE 208

  Fly   204 RDLLNETWRVMSLNHDWNGVEFISTVEHIKYPFYGVQFHPEKPLYE--FT---KTSIPHTAAAVL 263
            ...|.:.|..::...|.:|:|||:.|||.::|.:|.|||||:..:|  |.   |..:.|:...:.
  Fly   209 SYGLAKDWHPLATQKDTSGLEFITIVEHRRFPIFGCQFHPERAAFEQLFNSPDKCYMAHSRMGID 273

  Fly   264 SGQFFADFFVSEARESNQSFSNATEQARTLIYNYKPEYT-SILGSSYIQQYLF-TNVEMEIPEIP 326
            ..|.|...||...|.:|..|.:...:.|.||:|::|.:: ...||::.|.||| .||:..     
  Fly   274 LSQIFGSRFVDFCRRNNNQFESDKLKTRHLIWNWQPVFSGKFKGSNWQQCYLFEKNVDYS----- 333

  Fly   327 EIPDE 331
            |.||:
  Fly   334 EEPDD 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)72DpNP_730119.1 Peptidase_C26 26..244 CDD:285023 88/234 (38%)
GATase1_Glutamyl_Hydrolase 28..303 CDD:153218 105/297 (35%)
l(3)72DrNP_730120.1 GATase1_Glutamyl_Hydrolase 23..313 CDD:153218 103/291 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461662
Domainoid 1 1.000 96 1.000 Domainoid score I2455
eggNOG 1 0.900 - - E1_KOG1559
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I1792
Isobase 1 0.950 - 0 Normalized mean entropy S7038
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539287at33208
OrthoFinder 1 1.000 - - FOG0002965
OrthoInspector 1 1.000 - - otm43011
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5199
SonicParanoid 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.