DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)72Dp and LOC100490929

DIOPT Version :9

Sequence 1:NP_730119.1 Gene:l(3)72Dp / 317887 FlyBaseID:FBgn0263607 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_012814849.1 Gene:LOC100490929 / 100490929 -ID:- Length:311 Species:Xenopus tropicalis


Alignment Length:319 Identity:125/319 - (39%)
Similarity:184/319 - (57%) Gaps:12/319 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKFSISLLIFIGALL--AASEAGISSPIIGVLTQEVYVDGLISRHFDNKTSYIAASYVKYLEGA 63
            |...|::||:| |.||  ||.....:.||||::.||| .|   ...|....:|||.||||:||.|
 Frog     1 MAPLSLALLLF-GWLLPGAAGTELNNRPIIGIVAQEV-TD---KEFFPFGATYIADSYVKFLESA 60

  Fly    64 GARVVPIWIGRNRSYYDDLMRKINGVLLPGGATWFNQSNGYADAGEHLIHLAIELNDQGVFMPVW 128
            |:|||||.:......|..|.:.|||||.|||:... |.:.::........||:|.:..|.:.|:|
 Frog    61 GSRVVPIRLNLPEEEYRKLFKSINGVLFPGGSVDL-QVSSFSRTTRIFYKLAVEASSSGHYFPIW 124

  Fly   129 GTCLGMELLVYKLANETEHRINCEATGMAVPMEFKEDYKKSRLFASITDDVVDTMVKENVTYHWH 193
            |||:|.::|. .|....:......|..:::|:...::...||:|.....|::..:.:|.||.::|
 Frog   125 GTCMGFQILT-ALTAGADLLSATAAENISLPLNLTDEVASSRMFHHAPPDLLRVLSQERVTANFH 188

  Fly   194 QFCYTEKDFERD-LLNETWRVMSLNHDWNGVEFISTVEHIKYPFYGVQFHPEKPLYEF-TKTSIP 256
            .|..|.:.|..: .|:|.:||:|.|.|.||||||||:|...:|.||||:|||...::: :..|.|
 Frog   189 HFGLTPETFRANKKLSEFYRVLSTNRDTNGVEFISTIEARNHPIYGVQWHPEVNRFQWRSDMSYP 253

  Fly   257 HTAAAVLSGQFFADFFVSEARESNQSFSNATEQARTLIYNYKPEYTSILGSSYIQQYLF 315
            |:|.|:.:.|:||||||:|||:|...|.:..|:...||||:.|.||:.: |.|.|.|.|
 Frog   254 HSANAIWTSQYFADFFVNEARKSQNHFLSEEEENAALIYNWTPTYTANI-SGYEQAYFF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)72DpNP_730119.1 Peptidase_C26 26..244 CDD:285023 83/218 (38%)
GATase1_Glutamyl_Hydrolase 28..303 CDD:153218 107/276 (39%)
LOC100490929XP_012814849.1 GAT_1 29..299 CDD:381760 106/275 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I4468
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I3642
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539287at33208
OrthoFinder 1 1.000 - - FOG0002965
OrthoInspector 1 1.000 - - mtm9470
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5199
SonicParanoid 1 1.000 - - X1961
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.