DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and Prmt3

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_446009.1 Gene:Prmt3 / 89820 RGDID:620413 Length:528 Species:Rattus norvegicus


Alignment Length:374 Identity:106/374 - (28%)
Similarity:177/374 - (47%) Gaps:52/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PNP-QDATQARSKTRVRSAGRIPAPPRKVPKELEDLDRMTSADFRHDTAARLDV--------MRN 189
            ||. .:.|.|..|.::..|..:.| ...:.:..|||.:|  ..|..|....:||        :.:
  Rat   147 PNGLSENTSAVEKLKLMEARALSA-EAALARAREDLQKM--KQFAQDFVMNVDVRTCSSTTTIAD 208

  Fly   190 RQKDQAHMYF---------------------FQSVIHHQRHLIKDRTILVLCCGTGTLALMAAQM 233
            .|:|:..:||                     ::..|:...|:.||:.:|.:.||||.|::.||:.
  Rat   209 LQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKA 273

  Fly   234 GAKRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDLKLPT-KVDGIICNWMGYCLLYESEI 297
            |||:|.|||.|::......::|.|..|..|.::.|:::::.||. |||.||..||||.||:||.:
  Rat   274 GAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESML 338

  Fly   298 LEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRNVYGFNMNAIRRYALAEPCVAL 362
            ..||.|:.::|.|||.:.||:..:.|||..:....::|...|.:||||||:.:::..:.|..|.:
  Rat   339 DSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEV 403

  Fly   363 TTGKKLLTMAHCVLRLDLKRARREDLFIDRNIRLSVNR-------EGYLECFLLFFEVQFSNSLN 420
            ...|.|::....:..:|.......||....:..|...:       .||   |.::||....|.:.
  Rat   404 VDHKTLISDPCDIKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAVAGY---FDIYFEKNCHNRVV 465

  Fly   421 FKLSCNPCLKSPFKSLWMQSVLFVEQPFVMRKNIHYTGNLKFKTLKPNK 469
            |  |..|   ...|:.|.|::..:|:||.::......|.:   |:..||
  Rat   466 F--STGP---QSTKTHWKQTIFLLEKPFPVKAGEALKGKI---TVHKNK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 43/100 (43%)
Prmt3NP_446009.1 zf-C2H2_2 48..>97 CDD:289522
AdoMet_MTases 256..356 CDD:100107 43/99 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.