DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and PRMT6

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001326463.1 Gene:PRMT6 / 821541 AraportID:AT3G20020 Length:443 Species:Arabidopsis thaliana


Alignment Length:408 Identity:118/408 - (28%)
Similarity:191/408 - (46%) Gaps:59/408 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KISLLQRPNPQDATQARSKTRVRSAGRIP----APPRKVPKEL---EDLDRMTSA-----DFRHD 179
            ::.|..:..|..::..|:|.|..:..|.|    |...:|..:|   :.|:...|:     ||  |
plant    18 ELELEDKQGPSLSSFGRAKKRSHAGARDPRGGLANVLRVSDQLGEHKSLETSESSPPPCTDF--D 80

  Fly   180 TA-----ARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLALMAAQMGAKRVY 239
            .|     |.:.:.....||:|....::..|...:.||:.:.::.:.||||.|::..||.||||||
plant    81 VAYFHSYAHVGIHEEMIKDRARTETYREAIMQHQSLIEGKVVVDVGCGTGILSIFCAQAGAKRVY 145

  Fly   240 AVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDLKLPTKVDGIICNWMGYCLLYESEILEVLEAR 304
            |||.|.:......||:.||....:.|::||::|:::..:||.||..||||.|||||.:..|:.||
plant   146 AVDASDIAVQAKEVVKANGLSDKVIVLHGRVEDVEIDEEVDVIISEWMGYMLLYESMLGSVITAR 210

  Fly   305 DRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRNVYGFNMNAI----RRYALAEPCVALTTG 365
            |||||.||.|||..|.||:.........|...:.||||||.:|:|:    ::.|..||.|...:|
plant   211 DRWLKPGGLILPSHATLYMAPISHPDRYSHSIDFWRNVYGIDMSAMMQLAKQCAFEEPSVESISG 275

  Fly   366 KKLLTMAHCVLRLDLKRARREDL-FIDRNIRLSVNREGYLECFLLFFEVQF-------------- 415
            :.:||....|..:|.|..:.::| .:....:.:......:..|..:|:|:|              
plant   276 ENVLTWPEVVKHIDCKTIKIQELDSVTARYKFNSMMRAPMHGFAFWFDVEFSGPASSPAKNTSET 340

  Fly   416 -----------SNSLNFKLSCNP--------CLKSPFKSLWMQSVLFVEQPFVMRKNIHYTGNLK 461
                       |..:|.|...||        ..:|| .:.|.|::::...|..:.::....|::.
plant   341 SIASGSSSISPSGEVNQKKRTNPSDALVLSTSPESP-PTHWQQTIVYFYDPIDVEQDQVIEGSVT 404

  Fly   462 FKTLKPNKFNEMEICIEF 479
            ....|.|| ..|.|.:|:
plant   405 LSQSKENK-RFMNIHLEY 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 48/99 (48%)
PRMT6NP_001326463.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.