DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and PRMT1A

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_179557.1 Gene:PRMT1A / 816486 AraportID:AT2G19670 Length:366 Species:Arabidopsis thaliana


Alignment Length:314 Identity:105/314 - (33%)
Similarity:176/314 - (56%) Gaps:12/314 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 DRMTSADFRHDTAARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLALMAAQM 233
            |.:||||:..|:.:...:.....||......:|.||:..:.||||:.:|.:..|||.|:|..|:.
plant    40 DDITSADYYFDSYSHFGIHEEMLKDVVRTKSYQDVIYKNKFLIKDKIVLDVGAGTGILSLFCAKA 104

  Fly   234 GAKRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDLKLPT-KVDGIICNWMGYCLLYESEI 297
            ||..||||:.|::......:|:.||:..||||:.|::::::||. |||.||..||||.||||:.:
plant   105 GAAHVYAVECSQMADTAKEIVKSNGFSDVITVLKGKIEEIELPVPKVDVIISEWMGYFLLYENML 169

  Fly   298 LEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRNVYGFNMNAIRRYALAEPCVAL 362
            ..||.||::||..||.:|||.|:||:.|.|:...|.::...|.:||||:|:.|:|.|:.||.|..
plant   170 DTVLYARNKWLVDGGIVLPDKASLYVTAIEDAHYKDDKVEFWDDVYGFDMSCIKRRAITEPLVDT 234

  Fly   363 TTGKKLLTMAHCVLRLDLKRARREDLFIDRNIRLSVNREGYLECFLLFFEVQFS---NSLNFKLS 424
            ..|.:::|.:..:..:|:.:....|.......:|...|..::...:.:|:|.|:   ..:.|  |
plant   235 VDGNQIVTDSKLLKTMDISKMAAGDASFTAPFKLVAQRNDHIHALVAYFDVSFTMCHKKMGF--S 297

  Fly   425 CNPCLKSPFKSLWMQSVLFVEQPFVMRKNIHYTGNLKFKTLKPNKFNEMEICIE 478
            ..|..::   :.|.|:||::|....:.:....||::   |:..||.|..::.|:
plant   298 TGPKSRA---THWKQTVLYLEDVLTICEGETITGSM---TIAQNKKNPRDVDIK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 45/100 (45%)
PRMT1ANP_179557.1 AdoMet_MTases 87..187 CDD:100107 45/99 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.