DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and PRMT6

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_060607.2 Gene:PRMT6 / 55170 HGNCID:18241 Length:375 Species:Homo sapiens


Alignment Length:365 Identity:103/365 - (28%)
Similarity:172/365 - (47%) Gaps:58/365 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 PRKVPKELEDL-----------DRMTSADFRHDTAARLDVMRNRQKDQAHMYFFQSVIHHQRHLI 211
            ||:..:|.:.|           :.|.:...|.| |.||.::||..                  .:
Human    36 PRRTKRERDQLYYECYSDVSVHEEMIADRVRTD-AYRLGILRNWA------------------AL 81

  Fly   212 KDRTILVLCCGTGTLALMAAQMGAKRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDLKLP 276
            :.:|:|.:..|||.|::..||.||:|||||:.|.:......|||.||.|..:.|:.|.::.::||
Human    82 RGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELP 146

  Fly   277 TKVDGIICNWMGYCLLYESEILEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRN 341
            .:||.|:..||||.||:||.:..||.||.:|||:||.:||..|.|::....:..|: .|...|..
Human   147 EQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLE-WRLGFWSQ 210

  Fly   342 V---YGFNMNAIRRYAL------AEPCVALTTGKKLLTMAHCVLRLDLKRARRE---DLFIDRNI 394
            |   ||.:|:.:..:|.      :|..|...:|:.:|.......:|:|.||..|   :..:....
Human   211 VKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRF 275

  Fly   395 RLSVNREGYLECFLLFFEVQFSNSLNFKLSCNPCL--KSPF--KSLWMQSVLFVEQPFVMRKNIH 455
            |.|......:..|.::|:|.|....:.|    |.:  .|||  .:.|.|::|::.:|..:.::..
Human   276 RCSCYGSAPMHGFAIWFQVTFPGGESEK----PLVLSTSPFHPATHWKQALLYLNEPVQVEQDTD 336

  Fly   456 YTGNLKFKTLKPNKFN--EMEICIEFYEG--REYDYDLVM 491
            .:|.:   ||.|::.|  .:.:.:.:..|  .|...|..|
Human   337 VSGEI---TLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAM 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 46/99 (46%)
PRMT6NP_060607.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 1/1 (100%)
AdoMet_MTases 67..>200 CDD:418430 56/151 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.