DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and Prmt2

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001020315.1 Gene:Prmt2 / 499420 RGDID:1565519 Length:445 Species:Rattus norvegicus


Alignment Length:360 Identity:106/360 - (29%)
Similarity:165/360 - (45%) Gaps:47/360 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 RVRSAGRIPAPPRKVPKELEDLD-RMTSADFRH-DTAARLDVMRNRQKDQAHMYFFQSVIHHQRH 209
            |....|.|||  ..:.|::|:.| ..|..|..: |:...|.:......||.....:.|||...:.
  Rat    84 RAGCCGYIPA--NHLGKQVEEYDPEDTWQDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKE 146

  Fly   210 LIKDRTILVLCCGTGTLALMAAQMG-AKRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDL 273
            .:||:.||.:.||||.::|..|... .|.||||:.|.:..:|..:|.|||:...|||...:::|:
  Rat   147 SLKDKVILDVGCGTGIISLFCAHHARPKAVYAVEASDMAQHTGQLVLQNGFADTITVFQQKVEDV 211

  Fly   274 KLPTKVDGIICNWMGYCLLYESEILEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNH 338
            .||.|||.::..|||.|||:|..|..:|.|||.|||:.|.|.|..|||:||.....|....:...
  Rat   212 VLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGIIWPTTAALHLVPCSAEKDYHSKVLF 276

  Fly   339 WRNVYGFNMNAIRRYA-------------------LAEPCVALTTGKKLLTMAHCVLRLDLKRAR 384
            |.|.|.||::|::..|                   |:|||.              :|:||::..:
  Rat   277 WDNAYEFNLSALKSLAIKEFFSRPKSNHILKPEDCLSEPCT--------------ILQLDMRTVQ 327

  Fly   385 REDLFIDR-NIRLSVNREGYLECFLLFFEVQFSNSLNFK----LSCNPCLKSPFKSLWMQSVLFV 444
            ..||...| .:|..:.:.|.|..|..:|.|.|.:....:    ||..|...:   :.|.|::..:
  Rat   328 VSDLETMRGELRFDIQKAGTLHGFTAWFSVHFQSLEEGQPQQVLSTGPLHPT---THWKQTLFMM 389

  Fly   445 EQPFVMRKNIHYTGNLKFKTLKPNKFNEMEICIEF 479
            :.|..:......||::..:. .|.....|.:|:.:
  Rat   390 DDPVPVHTGDVVTGSVVLQR-NPVWRRHMSVCLSW 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 44/100 (44%)
Prmt2NP_001020315.1 SH3_PRMT2 46..98 CDD:212740 5/15 (33%)
AdoMet_MTases 153..253 CDD:100107 44/99 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.