DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and Art1

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster


Alignment Length:333 Identity:109/333 - (32%)
Similarity:184/333 - (55%) Gaps:18/333 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 AGRIPAPPRKVPKELEDLDRMTSADFRHDTAARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRT 215
            |.::||..........:.|.|||.|:..|:.|...:.....||:.....:::.::|.:||.:.:|
  Fly    30 AKKLPAEGSTGDNPNANADEMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKT 94

  Fly   216 ILVLCCGTGTLALMAAQMGAKRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDLKLPTKVD 280
            :|.:.||||.|::.||:.||.:|.|||.|.:..:...||..|..:.||||:.|::::::||..::
  Fly    95 VLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIE 159

  Fly   281 G---IICNWMGYCLLYESEILEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRNV 342
            |   ||..||||||.|||.:..||.|||:||||.|.:.||...||:.|.|:.:.|.|:.|.|.:|
  Fly   160 GVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDV 224

  Fly   343 YGFNMNAIRRYALAEPCVALTTGKKLLTMAHCVLRLDLKRARREDLFIDRNIRLSVNREGYLECF 407
            |||:|:.||:.|:.||.|.:...|::::.:..|..:||...::.||.......|.:.|..:::..
  Fly   225 YGFDMSCIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRNDFVQAL 289

  Fly   408 LLFFEVQFSNSLNFKLSCNPCL---KSPFKSL--WMQSVLFVEQPFVMRKNIHYTGNLKFKTLKP 467
            :.:|.::|:       .|:..|   .||..:.  |.|:|.:::.....:||...||..:   :||
  Fly   290 VTYFNIEFT-------KCHKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQ---MKP 344

  Fly   468 NKFNEMEI 475
            |:.|..::
  Fly   345 NERNNRDL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 48/102 (47%)
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 47/99 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440103
Domainoid 1 1.000 84 1.000 Domainoid score I1911
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.