DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and Carm1

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001025212.1 Gene:Carm1 / 363026 RGDID:1305879 Length:608 Species:Rattus norvegicus


Alignment Length:305 Identity:79/305 - (25%)
Similarity:138/305 - (45%) Gaps:19/305 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLALMAAQMGAKRVYAVDYSKVTG 248
            |...:|..:|......:|..|.......||:.:|.:.||:|.|:..|||.||:::|||:.|.:..
  Rat   157 LSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQ 221

  Fly   249 YTTLVVRQNGYEGVITVMNGRMKDLKLPTKVDGIICNWMGYCLLYESEILEVLEARDRWLKKGGF 313
            :..::|:.|.....|.|:.|:::::.||.:||.||...|||.|..|..:...|.|: ::||..|.
  Rat   222 HAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAK-KYLKPSGN 285

  Fly   314 ILPDLAALYLVASEEHKLKSE---RCNHW--RNVYGFNMNAIRRYALAE----PCVALTTGKKLL 369
            :.|.:..::|....:.:|..|   :.|.|  .:.:|.:::|:|..|:.|    |.|. |...::|
  Rat   286 MFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVD-TFDIRIL 349

  Fly   370 TMAHCVLRLDLKRARREDLF-IDRNIRLSVNREGYLECFLLFFEVQFSNS-LNFKLSCNPCLKSP 432
            ........::...|:..||. |:...:..:...|.:.....:|:|.|..| :...||..|  ..|
  Rat   350 MAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAP--TEP 412

  Fly   433 FKSLWMQSVLFVEQPFVMRKNIHYTGNLKFKTLKPNKFNEMEICI 477
            . :.|.|.....:.|...:.....:|..   .|..||....:|.|
  Rat   413 L-THWYQVRCLFQSPLFAKAGDTLSGTC---LLIANKRQSYDISI 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 35/99 (35%)
Carm1NP_001025212.1 CARM1 35..139 CDD:402914
AdoMet_MTases 189..284 CDD:100107 34/95 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.