DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and Prmt7

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001014175.1 Gene:Prmt7 / 361402 RGDID:1304869 Length:693 Species:Rattus norvegicus


Alignment Length:337 Identity:68/337 - (20%)
Similarity:125/337 - (37%) Gaps:89/337 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 EDLDRMTSADFRHDTAARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDR--TILVLCCGTGT--L 226
            :::.|.:.||..||            ||: ::.::|. |......:||:  ..|||..||||  |
  Rat    28 QEIARSSYADMLHD------------KDR-NIKYYQG-IRAAVSRVKDKGQKALVLDIGTGTGLL 78

  Fly   227 ALMAAQMGAKRVYAVDYSKVTGYTTL-VVRQNGYEGVITVMNGRMKDL------KLPTKVDGIIC 284
            ::||...||...|||:..|......: :|.:||:...|.|:|....::      .||.:.:.::.
  Rat    79 SMMAVTAGADFCYAVEVFKPMAEAAVKIVEKNGFSDKIKVINKHSTEVTVGPDGDLPCRANILVT 143

  Fly   285 NWMGYCLLYESEILEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKS---------------- 333
            ......|:.|..:.....|....:::....:|..|.:|....|..::.|                
  Rat   144 ELFDTELIGEGALPSYEHAHKHLVQEDCEAVPHRATVYAQLVESKRMWSWNKLFPVRVQTGLGEQ 208

  Fly   334 --------ERCNHWRNVYGFNMNAIRR---YALAE--PCVALTTGKKLLTMAHCVLRLDLKRARR 385
                    |||....:||...:|.:..   ..|::  |..::...|::.:.|.|..:..:..|  
  Rat   209 LIIPPSELERCPGAPSVYDIQLNQVSPADFTVLSDVLPMFSVDFSKQVSSSAACHSKQFVPLA-- 271

  Fly   386 EDLFIDRNIRLSVNREGYLECFLLFFEVQFSNSLNFKLSCNPCLKSPF-----------KSLWMQ 439
                           .|..:..|.:::::.......|     |..:||           :..|||
  Rat   272 ---------------SGQAQVVLSWWDIEMDPEGKIK-----CTMAPFWAQTDPQELQWRDHWMQ 316

  Fly   440 SVLFV--EQPFV 449
            .|.|:  |:|.:
  Rat   317 CVYFLPQEEPIM 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 27/108 (25%)
Prmt7NP_001014175.1 AdoMet_MTases 37..>188 CDD:302624 40/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.