DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and Art2

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster


Alignment Length:397 Identity:113/397 - (28%)
Similarity:187/397 - (47%) Gaps:76/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ERKKHSEKLD-NSKSANQTVKPENSDIKISLLQRPNPQDATQARSKTRVRSAGRIPAPPRKVPKE 164
            |..|..||:| |...|||.:|                                            
  Fly     4 ELAKDDEKMDGNHTDANQIIK-------------------------------------------- 24

  Fly   165 LEDLDRMTSADFRHDTAARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLALM 229
                ||....:.......|:::.....||...:..::..|.| ....:.:|:|.:.||.|.|::.
  Fly    25 ----DRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQH-NEFFRHKTVLDVGCGMGVLSMF 84

  Fly   230 AAQMGAKRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDLKLP---TKVDGIICNWMGYCL 291
            ||:.|:|||.||:.:.::.:...||:.|.:..||.|:.|:::|::||   .|||.|:|:|||.||
  Fly    85 AAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCL 149

  Fly   292 LYESEILEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRNVYGFNMNAIRRYALA 356
            ...:.:..:|.|||:||...|.|.||.|.|||.|.   |.:.:....|.:|:||:::||||...:
  Fly   150 FSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAI---KGRDQDLGFWHDVHGFDLSAIRRRCES 211

  Fly   357 EPCVALTTGKKLLTMAHCVLRLDL-----KRARREDLFIDRNIRLSVNREGYLECFLLFFEVQFS 416
            :..|...||.::::....|..|||     :.|:...||     .|.|:|.|::...:.:|:|.||
  Fly   212 KAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLF-----ELKVSRNGWVHGLVAYFDVGFS 271

  Fly   417 NSLNFKLSCNPCLKSPFKSLWMQSVLFVEQPFVMRKNIHYTGNLKFKTLKPNKFN----EMEICI 477
            .|.. ::|.:....:|: :.|.|:|.::|.|..:|......|.|   |:||::.:    |.:|.:
  Fly   272 KSTQ-RISFSTSPSAPW-THWNQTVFYLETPLPVRAGECIKGVL---TMKPSEDSIFDTEFDIFV 331

  Fly   478 EFYEGRE 484
            .| :|||
  Fly   332 NF-DGRE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 41/102 (40%)
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 33/79 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440107
Domainoid 1 1.000 84 1.000 Domainoid score I1911
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.