DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and PRMT1

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001527.3 Gene:PRMT1 / 3276 HGNCID:5187 Length:371 Species:Homo sapiens


Alignment Length:343 Identity:110/343 - (32%)
Similarity:185/343 - (53%) Gaps:16/343 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ELEDLDRMTSADFRHDTAARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLAL 228
            |..:.:.|||.|:..|:.|...:.....||:.....:::.:.|.|||.||:.:|.:..|||.|.:
Human    40 EKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCM 104

  Fly   229 MAAQMGAKRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDLKLPT-KVDGIICNWMGYCLL 292
            .||:.||::|..::.|.::.|...:|:.|..:.|:|::.|::::::||. |||.||..||||||.
Human   105 FAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLF 169

  Fly   293 YESEILEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRNVYGFNMNAIRRYALAE 357
            |||.:..||.|||:||...|.|.||.|.||:.|.|:.:.|..:.:.|.|||||:|:.|:..|:.|
Human   170 YESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKE 234

  Fly   358 PCVALTTGKKLLTMAHCVLRLDLKRARREDLFIDRNIRLSVNREGYLECFLLFFEVQFSN-SLNF 421
            |.|.:...|:|:|.|..:..:|:...:.|||.......|.|.|..|:...:.:|.::|:. ....
Human   235 PLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRT 299

  Fly   422 KLSCNPCLKSPFKSLWMQSVLFVEQPFVMRKNIHYTGNLKFKT--LKPNKFNEMEICIEFYEGRE 484
            ..|.:|  :||: :.|.|:|.::|....::     ||...|.|  ::||..|..::....    :
Human   300 GFSTSP--ESPY-THWKQTVFYMEDYLTVK-----TGEEIFGTIGMRPNAKNNRDLDFTI----D 352

  Fly   485 YDYDLVMCTLRVAKRWLM 502
            .|:...:|.|..:..:.|
Human   353 LDFKGQLCELSCSTDYRM 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 41/100 (41%)
PRMT1NP_001527.3 AdoMet_MTases 92..192 CDD:100107 41/99 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.