DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and Prmt6

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001380787.1 Gene:Prmt6 / 295384 RGDID:1304701 Length:375 Species:Rattus norvegicus


Alignment Length:369 Identity:107/369 - (28%)
Similarity:174/369 - (47%) Gaps:60/369 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PAPPRKVPKELEDL-----------DRMTSADFRHDTAARLDVMRNRQKDQAHMYFFQSVIHHQR 208
            |..||:..:|.:.|           :.|.:...|.| |.||.::||..                 
  Rat    33 PPRPRRTKRERDQLYYECYSDVSVHEEMIADRVRTD-AYRLGILRNWA----------------- 79

  Fly   209 HLIKDRTILVLCCGTGTLALMAAQMGAKRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDL 273
             .::.:|:|.:..|||.|::..||.||:|||||:.|.:......|||.||.|..:.::.|.::.:
  Rat    80 -ALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAQEVVRLNGLEDRVHILPGPVETV 143

  Fly   274 KLPTKVDGIICNWMGYCLLYESEILEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNH 338
            :||.:||.|:..||||.||:||.:..||.||.:|||:||.:|||.|.|: ||....::...|...
  Rat   144 ELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPDSAELF-VAPISDQMLEWRLGF 207

  Fly   339 WRNV---YGFNMNAIRRYAL------AEPCVALTTGKKLLTMAHCVLRLDLKRARRE---DLFID 391
            |..|   ||.:|:.:..:|.      :|..|...:|:.:|.......:|:|.||..|   :..:.
  Rat   208 WSQVKQHYGVDMSCMESFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELARAGLEQELEAGVG 272

  Fly   392 RNIRLSVNREGYLECFLLFFEVQFSNSLNFK---LSCNPCLKSPF--KSLWMQSVLFVEQPFVMR 451
            ...|.|......|..|.::|:|.|....:.|   ||     .|||  .:.|.|::|::.:|..:.
  Rat   273 GRFRCSCYGSAPLHGFAIWFQVTFPGGDSEKPLVLS-----TSPFHPATHWKQALLYLNEPVPVE 332

  Fly   452 KNIHYTGNLKFKTLKPNKFN--EMEICIEFYEG--REYDYDLVM 491
            ::...:|.:   ||.|::.|  .:.:.:.:..|  .|...|..|
  Rat   333 QDTDISGEI---TLLPSRDNPRRLRVLLRYKVGDHEEKTKDFAM 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 45/99 (45%)
Prmt6NP_001380787.1 AdoMet_MTases 85..185 CDD:100107 45/99 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.