DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and rmt1

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_594825.2 Gene:rmt1 / 2543492 PomBaseID:SPAC890.07c Length:340 Species:Schizosaccharomyces pombe


Alignment Length:314 Identity:100/314 - (31%)
Similarity:164/314 - (52%) Gaps:16/314 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 MTSADFRHDTAARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLALMAAQMGA 235
            :|:.|:..|:.:...:.....||......::..|....||.:|:.:|.:.||||.|::..|:.||
pombe    13 LTAKDYYFDSYSHWGIHEEMLKDDVRTLSYRDAIMQNPHLFRDKIVLDVGCGTGILSMFCARAGA 77

  Fly   236 KRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDLKLPT-KVDGIICNWMGYCLLYESEILE 299
            |.||.||.|::......:|..|.....||::.|:|::::||. |||.|:..||||.|||||.:..
pombe    78 KHVYGVDMSEIIHKAVQIVEVNKLSDRITLIQGKMEEIQLPVEKVDIIVSEWMGYFLLYESMLDT 142

  Fly   300 VLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRNVYGFNMNAIRRYALAEPCVALTT 364
            ||.||||:|...|.:.||.|.:.|.|.|:...|||:...|.:||||:.:.|::....||.|....
pombe   143 VLVARDRYLAPDGLLFPDRAQIQLAAIEDADYKSEKIGFWDDVYGFDFSPIKKDVWKEPLVDTVD 207

  Fly   365 GKKLLTMAHCVLRLDLKRARREDLFIDRNIRLSVNREGYLECFLLFFEVQFSNSLNFKLSCNPCL 429
            ...:.|.:..:|.||||..::|||.......::..|..::..||.:|:::||       :|:..:
pombe   208 RIAVNTNSCVILDLDLKTVKKEDLAFSSPFEITATRNDFVHAFLAWFDIEFS-------ACHKPI 265

  Fly   430 K---SPFK--SLWMQSVLFVEQPFVMRKNIHYTGNLKFKTLKPNKFNEMEICIE 478
            |   .||.  :.|.|:|.:..:...::...:..|.:   |.||.:.|..|:.|:
pombe   266 KFSTGPFSRYTHWKQTVFYTHKDLTVKAGEYIRGTI---TCKPAEGNHRELDID 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 44/100 (44%)
rmt1NP_594825.2 AdoMet_MTases 58..158 CDD:100107 44/99 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.