DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32152 and LOC100361025

DIOPT Version :9

Sequence 1:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_038948788.1 Gene:LOC100361025 / 100361025 RGDID:2320935 Length:353 Species:Rattus norvegicus


Alignment Length:343 Identity:109/343 - (31%)
Similarity:184/343 - (53%) Gaps:16/343 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ELEDLDRMTSADFRHDTAARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLAL 228
            |..:.:.|||.|:..|:.|...:.....||:.....:::.:.|.|||.||:.:|.:..|||.|.:
  Rat    22 EKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCM 86

  Fly   229 MAAQMGAKRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDLKLPT-KVDGIICNWMGYCLL 292
            .||:.||::|..::.|.::.|...:|:.|..:.|:|::.|::::::||. |||.||..||||||.
  Rat    87 FAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLF 151

  Fly   293 YESEILEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRNVYGFNMNAIRRYALAE 357
            |||.:..||.|.|:||...|.|.||.|.||:.|.|:.:.|..:.:.|.|||||:|:.|:..|:.|
  Rat   152 YESMLNTVLHAHDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKE 216

  Fly   358 PCVALTTGKKLLTMAHCVLRLDLKRARREDLFIDRNIRLSVNREGYLECFLLFFEVQFSN-SLNF 421
            |.|.:...|:|:|.|..:..:|:...:.|||.......|.|.|..|:...:.:|.::|:. ....
  Rat   217 PLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRT 281

  Fly   422 KLSCNPCLKSPFKSLWMQSVLFVEQPFVMRKNIHYTGNLKFKT--LKPNKFNEMEICIEFYEGRE 484
            ..|.:|  :||: :.|.|:|.::|....::     ||...|.|  ::||..|..::....    :
  Rat   282 GFSTSP--ESPY-THWKQTVFYMEDYLTVK-----TGEEIFGTIGMRPNAKNNRDLDFTI----D 334

  Fly   485 YDYDLVMCTLRVAKRWLM 502
            .|:...:|.|..:..:.|
  Rat   335 LDFKGQLCELSCSTDYRM 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 40/100 (40%)
LOC100361025XP_038948788.1 AdoMet_MTases 74..174 CDD:100107 40/99 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.