DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxf3 and NXF3

DIOPT Version :9

Sequence 1:NP_001287064.2 Gene:Nxf3 / 317878 FlyBaseID:FBgn0263232 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_071335.1 Gene:NXF3 / 56000 HGNCID:8073 Length:531 Species:Homo sapiens


Alignment Length:499 Identity:104/499 - (20%)
Similarity:185/499 - (37%) Gaps:122/499 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NEKSKIREYVQELIGNEQQM--------GSVLDTISSTEEDHRVATVTGWSTVNIANCAGVSNSS 94
            |.|...|:..|..:..|::.        |::.|           .|:..|..:.:.  .|:..:.
Human    75 NRKGSFRKQDQTHVNMEREQKPPERRMEGNMPD-----------GTLGSWFKITVP--FGIKYNE 126

  Fly    95 IFVALKWVMMPIKVEI--------FNFKRSGPEDNMARGQFLLDNLLSANRLKRLQEEVAVINTC 151
                 ||::..|:.|.        |::      :|| ...|.::|...|..||.:..::...:. 
Human   127 -----KWLLNLIQNECSVPFVPVEFHY------ENM-HASFFVENASIAYALKNVSGKIWDEDN- 178

  Fly   152 QKIEVRVTP-GLPKSMMCAQITDEFTTAIQEALRSRYEVDSRTLDLSRFHASPELSLHFCPLHMV 215
            :||.:.|.| |:| ..:..::..|....|:.|:..:.:|....||:.|....|:         ||
Human   179 EKISIFVNPAGIP-HFVHRELKSEKVEQIKLAMNQQCDVSQEALDIQRLPFYPD---------MV 233

  Fly   216 -----------KLLETVLVLSNHLFPHVTSLVLSNNYLCSLKAFAGNSQSFASLERLDISANRIQ 269
                       |.:...|.:.....|.|.|              ||....:..:|..:..|:|  
Human   234 NRDTKMASNPRKCMAASLDVHEENIPTVMS--------------AGEMDKWKGIEPGEKCADR-- 282

  Fly   270 DLGELNYINKLSCKTIFLAGNGLAKLSVDVIRKMLPQLKNVHG--------CVQLGESTEAVDNI 326
                     ...|.|.....:     :::.|.::.|:|..:.|        |     .|||...:
Human   283 ---------SPVCTTFSDTSS-----NINSILELFPKLLCLDGQQSPRATLC-----GTEAHKRL 328

  Fly   327 PKSQQLQGG--GTNGLK-FCQDFISSYYTFFDDTEERFKLKKYYDDQAMFSLSVP------VQLN 382
            |   ..:|.  |:..|| ....|:..||..:|..:.:..|..|: |:|.||||:|      ...:
Human   329 P---TCKGSFFGSEMLKNLVLQFLQQYYLIYDSGDRQGLLSAYH-DEACFSLSIPFNPEDSAPSS 389

  Fly   383 YVYGYKLYNRNQKRQHSSFAQNAKLQVGRAALLLALSRLPLMHTDLENVGLDIQVFTSSLRIFTL 447
            :...:| .:||.|.....:.:...|:..:..::.:||.||....||.:..:|:...|..:..|::
Human   390 FCKFFK-DSRNIKILKDPYLRGELLKHTKLDIVDSLSALPKTQHDLSSFLVDMWYQTEWMLCFSV 453

  Fly   448 TGYFKEISSDTL-EPRRFQRTFVLQTSNSPGWLITNDMLCITST 490
            .|.|||:...:. ....|.|||:....:|....|.||.|.:..|
Human   454 NGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVNDKLFVRDT 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxf3NP_001287064.2 leucine-rich repeat 191..231 CDD:275382 8/50 (16%)
PPP1R42 <192..296 CDD:411060 18/114 (16%)
leucine-rich repeat 232..257 CDD:275382 4/24 (17%)
leucine-rich repeat 258..281 CDD:275382 3/22 (14%)
NTF2_like 338..489 CDD:415585 42/158 (27%)
NXF3NP_071335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..59
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..106 3/22 (14%)
Tap-RNA_bind 110..192 CDD:312616 20/97 (21%)
noncanonical RNP-type RNA-binding (RBD) domain 115..192 19/92 (21%)
leucine-rich repeat (LRR) domains 193..329 30/179 (17%)
leucine-rich repeat 218..260 CDD:275382 8/50 (16%)
leucine-rich repeat 275..305 CDD:275382 5/45 (11%)
nuclear transport factor 2 (NTF2)-like domain 339..461 33/123 (27%)
NTF2 341..496 CDD:238403 42/156 (27%)
ubiquitin-associated domain 524..531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051093at2759
OrthoFinder 1 1.000 - - FOG0000862
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.