DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxf3 and nxf4

DIOPT Version :9

Sequence 1:NP_001287064.2 Gene:Nxf3 / 317878 FlyBaseID:FBgn0263232 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_731156.1 Gene:nxf4 / 40884 FlyBaseID:FBgn0051501 Length:301 Species:Drosophila melanogaster


Alignment Length:239 Identity:56/239 - (23%)
Similarity:104/239 - (43%) Gaps:29/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TVTGWSTVNI-ANCAGVSNSSIFVALKWVMMPIKVEIFNFKRSG-----PEDNMARGQFLLDNLL 133
            ::.||..|.| :....::.:.:...::.::.|:|:.. .:|.:|     .||:.|...|.:|:..
  Fly    39 SIYGWYRVLIYSTDRRLTFNRVLRRIRCILTPLKINP-RYKHTGGEQDTAEDSWALFTFFVDSYD 102

  Fly   134 SANRLKRLQEEVAVINTCQKIEVRVTPGLPK----SMMCAQITDEFTTAIQEALRSRYEVDSRTL 194
            .|:.|.|   ...|.|   :|.::|:..:||    |::...:|        ..|..||:...|:|
  Fly   103 VASALFR---RGWVDN---QIWLKVSDRMPKIWINSILRLHLT--------MVLLDRYDPVERSL 153

  Fly   195 DLSRFHASPELSLHFCPLHMVKLLETVLVLSNHLFPHVTSLVLSNNYLCSLKAFAGNSQSFASLE 259
            ||:.|:....|...|..|.....:.|||.:.:...|.:..|:|..|:|.:|..|....:.|..|.
  Fly   154 DLTLFYKDKALCGEFFALAESNCMSTVLGIVDREMPELERLILDGNHLTNLWVFRKVERRFPRLH 218

  Fly   260 RLDISANRIQDLGELNYINKLSCKTIFLAGN----GLAKLSVDV 299
            .:.:..|.|:::..|..:..|....:.|..|    |..|..:|:
  Fly   219 SISLKHNDIENIYSLRNLQFLPLAELNLLDNPLPAGYEKEVLDI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxf3NP_001287064.2 leucine-rich repeat 191..231 CDD:275382 11/39 (28%)
PPP1R42 <192..296 CDD:411060 28/107 (26%)
leucine-rich repeat 232..257 CDD:275382 7/24 (29%)
leucine-rich repeat 258..281 CDD:275382 4/22 (18%)
NTF2_like 338..489 CDD:415585
nxf4NP_731156.1 leucine-rich repeat 150..190 CDD:275382 11/39 (28%)
LRR_4 189..235 CDD:289563 12/45 (27%)
leucine-rich repeat 191..216 CDD:275382 7/24 (29%)
leucine-rich repeat 217..240 CDD:275382 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450002
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.