DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxf3 and nxf4

DIOPT Version :10

Sequence 1:NP_729938.2 Gene:Nxf3 / 317878 FlyBaseID:FBgn0263232 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_731156.1 Gene:nxf4 / 40884 FlyBaseID:FBgn0051501 Length:301 Species:Drosophila melanogaster


Alignment Length:239 Identity:56/239 - (23%)
Similarity:104/239 - (43%) Gaps:29/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TVTGWSTVNI-ANCAGVSNSSIFVALKWVMMPIKVEIFNFKRSG-----PEDNMARGQFLLDNLL 133
            ::.||..|.| :....::.:.:...::.::.|:|:.. .:|.:|     .||:.|...|.:|:..
  Fly    39 SIYGWYRVLIYSTDRRLTFNRVLRRIRCILTPLKINP-RYKHTGGEQDTAEDSWALFTFFVDSYD 102

  Fly   134 SANRLKRLQEEVAVINTCQKIEVRVTPGLPK----SMMCAQITDEFTTAIQEALRSRYEVDSRTL 194
            .|:.|.|   ...|.|   :|.::|:..:||    |::...:|        ..|..||:...|:|
  Fly   103 VASALFR---RGWVDN---QIWLKVSDRMPKIWINSILRLHLT--------MVLLDRYDPVERSL 153

  Fly   195 DLSRFHASPELSLHFCPLHMVKLLETVLVLSNHLFPHVTSLVLSNNYLCSLKAFAGNSQSFASLE 259
            ||:.|:....|...|..|.....:.|||.:.:...|.:..|:|..|:|.:|..|....:.|..|.
  Fly   154 DLTLFYKDKALCGEFFALAESNCMSTVLGIVDREMPELERLILDGNHLTNLWVFRKVERRFPRLH 218

  Fly   260 RLDISANRIQDLGELNYINKLSCKTIFLAGN----GLAKLSVDV 299
            .:.:..|.|:::..|..:..|....:.|..|    |..|..:|:
  Fly   219 SISLKHNDIENIYSLRNLQFLPLAELNLLDNPLPAGYEKEVLDI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxf3NP_729938.2 leucine-rich repeat 191..231 CDD:275382 11/39 (28%)
LRR <229..>300 CDD:443914 18/75 (24%)
leucine-rich repeat 232..257 CDD:275382 7/24 (29%)
leucine-rich repeat 258..281 CDD:275382 4/22 (18%)
NTF2_like 338..489 CDD:471850
nxf4NP_731156.1 leucine-rich repeat 150..190 CDD:275382 11/39 (28%)
PPP1R42 <191..276 CDD:455733 17/72 (24%)
leucine-rich repeat 191..216 CDD:275382 7/24 (29%)
leucine-rich repeat 217..240 CDD:275382 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.