DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxf3 and nxf2

DIOPT Version :9

Sequence 1:NP_001287064.2 Gene:Nxf3 / 317878 FlyBaseID:FBgn0263232 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_524111.3 Gene:nxf2 / 39843 FlyBaseID:FBgn0036640 Length:841 Species:Drosophila melanogaster


Alignment Length:398 Identity:92/398 - (23%)
Similarity:155/398 - (38%) Gaps:75/398 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 IQEALRSRYEVDSRTLDLSRFHASPELSLHFCPLHMVKLLETVLVLSNHLFP---------HVTS 234
            ||:|:...|...:|.|:|.|||:...|......|...|:|..||.:::..|.         |...
  Fly   422 IQKAVSQCYVAQNRMLNLERFHSRECLKDVMVSLSSPKILTYVLSVASRKFMTTCSEIRLCHNKV 486

  Fly   235 LVLSNNYLCSLKAFAGNSQSFASLERLDISANRIQDLGELNYINKLSCKTIFLAGNGLAK----- 294
            |||...::..:         ...|..:|:|.|.:|||..::.:..|..|::.|.||.|.:     
  Fly   487 LVLDGAHVLGM---------MGCLRAVDLSHNWVQDLSSIHSLGNLPLKSLVLHGNKLCRNYRLP 542

  Fly   295 -LSVDVIRKMLPQLKNVHGCVQLGESTEAVD-NIPKSQQLQGG---GTNGLKFCQDFISSYYTFF 354
             ..|..::::.|||..:.|          || .....|.||..   .|...:....|:.:|...|
  Fly   543 SEYVRAVKEVFPQLTTLDG----------VDLQTNPGQSLQKNFLCDTGAYELVGAFLENYLREF 597

  Fly   355 DDTEERFKLKKYYDDQAMFSLS----------VPVQLNYVYGYKLYNRNQKRQHSSFAQNAKLQV 409
            ::.|.|..|.|||.:.::|:|:          .|..|..:..|..:.||.:.:..|.|.:. :..
  Fly   598 ENDEFRHNLYKYYSENSIFTLTCNYNVVQNHQTPKILQRLSKYNRHARNLRNKDYSKASDG-VFF 661

  Fly   410 GRAALLLALSRLPLMHTDLENVGLDIQVFTSSLRIFTLTGYFKEISSDTLEPR-----------R 463
            |...::..|.:||.:..|..::..|:..:.....:..:.|..::....|....           .
  Fly   662 GCTYIVEILLQLPRVTHDFHSLQTDVMHYNGKGAVIYVAGLLRDEPPSTRNGHGSKTDIGGVLLG 726

  Fly   464 FQRTFVLQTSNSPGWL--------ITNDMLCITSTMPDPKKT-IKFKPETNMINTDPSVEKINKP 519
            |.|.||:....:...|        |.|:.|.||    :|.|| |:.....|.  .|||..:..:.
  Fly   727 FSRQFVVTFDEANLGLGKRARRLKIANERLHIT----NPSKTAIRNAFSVNF--PDPSERQAEED 785

  Fly   520 AVTVLDRK 527
            ::.|.|.|
  Fly   786 SLDVKDHK 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxf3NP_001287064.2 leucine-rich repeat 191..231 CDD:275382 13/48 (27%)
PPP1R42 <192..296 CDD:411060 30/118 (25%)
leucine-rich repeat 232..257 CDD:275382 3/24 (13%)
leucine-rich repeat 258..281 CDD:275382 7/22 (32%)
NTF2_like 338..489 CDD:415585 35/179 (20%)
nxf2NP_524111.3 leucine-rich repeat 434..474 CDD:275382 13/39 (33%)
leucine-rich repeat 475..500 CDD:275382 4/33 (12%)
leucine-rich repeat 501..524 CDD:275382 7/22 (32%)
leucine-rich repeat 525..555 CDD:275382 6/29 (21%)
TAP_C 779..841 CDD:197882 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450004
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442228at33208
OrthoFinder 1 1.000 - - FOG0000862
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.