DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxf3 and nxf-2

DIOPT Version :9

Sequence 1:NP_001287064.2 Gene:Nxf3 / 317878 FlyBaseID:FBgn0263232 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_506568.2 Gene:nxf-2 / 179938 WormBaseID:WBGene00003835 Length:405 Species:Caenorhabditis elegans


Alignment Length:345 Identity:83/345 - (24%)
Similarity:152/345 - (44%) Gaps:37/345 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 IQEALRSRYEVDSRTLDLSRFHASPEL---SLHFCPLHMVKLLETVLVLSNHLFPHVTSLVLSNN 240
            :|:.:...|......|:||.|..:.|.   .:..| |...:::..||....:.:|.::.:..|||
 Worm    43 VQDVVDGCYVATDDVLNLSNFSKNTEFVERDMLMC-LTKTRVMSVVLQHIGYKYPRISGISFSNN 106

  Fly   241 YLCSLKAFAGNSQSFASLERLDISANRIQDLGELNYINKLSCKTIFLAGNGLAKLSV------DV 299
            .||.|...:..|.....|:.||:|.|:|....||..:..:..:|:|..||.:.:..|      :.
 Worm   107 RLCHLDHLSSLSSISKFLKFLDLSHNQISSGEELKKLGTIPVETVFFEGNPVCEKFVQCAEYANF 171

  Fly   300 IRKMLPQLKNVHGC-VQLGESTEAVDNIPKSQQLQGGGTNGLKFCQDFISSYYTFFDDT---EER 360
            |:|..|:..|:.|. |:.......::.|...:....|........::||.:||..:|..   :.|
 Worm   172 IQKTFPKCSNLDGMEVEPKPDHNRIEQIIPFRNGYYGSDEVRTLVEEFIITYYKIYDGADGQQTR 236

  Fly   361 FKLKKYYD-DQAMFSLSV-----PVQLNYVY----GYKLYNRNQKR--QHSSFAQN--AKLQVGR 411
            .:|...|| :.:.|:.:|     |::. .:|    .|::|.|....  ....||.|  :::..|.
 Worm   237 KQLLDAYDTNNSTFTHTVVCLWDPIKF-VMYPDSESYRMYLRTSHNVLNQEYFAANRASRISHGA 300

  Fly   412 AALLLALSRLPLMHTDLENVGLDIQVFTSSLRIFTLTGYFKEISSDTLEPRR-------FQRTFV 469
            ..:::||||||.....::...:|:.:.:::|..|||.|.|:: ....::|..       |.|||:
 Worm   301 MDIVVALSRLPATIHLMDTFVVDVFLVSATLLGFTLHGTFRD-GPSAIKPENTEEHDNYFTRTFM 364

  Fly   470 LQTSNSPGWLITNDMLCITS 489
            :.........|.:|.|.|:|
 Worm   365 VAPRGEGKVAIVSDQLFISS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxf3NP_001287064.2 leucine-rich repeat 191..231 CDD:275382 9/42 (21%)
PPP1R42 <192..296 CDD:411060 29/106 (27%)
leucine-rich repeat 232..257 CDD:275382 7/24 (29%)
leucine-rich repeat 258..281 CDD:275382 8/22 (36%)
NTF2_like 338..489 CDD:415585 42/174 (24%)
nxf-2NP_506568.2 leucine-rich repeat 55..97 CDD:275382 9/42 (21%)
leucine-rich repeat 98..123 CDD:275382 7/24 (29%)
leucine-rich repeat 124..147 CDD:275382 8/22 (36%)
leucine-rich repeat 148..178 CDD:275382 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159790
Domainoid 1 1.000 67 1.000 Domainoid score I6424
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051093at2759
OrthoFinder 1 1.000 - - FOG0000862
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.