DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp7Fc and CG42700

DIOPT Version :9

Sequence 1:NP_572485.1 Gene:Cp7Fc / 31786 FlyBaseID:FBgn0014466 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001286339.1 Gene:CG42700 / 36330 FlyBaseID:FBgn0261611 Length:509 Species:Drosophila melanogaster


Alignment Length:125 Identity:31/125 - (24%)
Similarity:37/125 - (29%) Gaps:30/125 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GTNEEYNRLINRTQNGVHEEVHHEYLPGAERPGS---AVQPPSPLPAPHQSRPAYR--------- 173
            ||.|..:.|     :|:.........|....||:   .:..|.||.....|....|         
  Fly    68 GTKERCSAL-----SGIPSTPLSSTAPSLALPGNLPYELDMPQPLVDRRPSVSLMRWSSSGPGTE 127

  Fly   174 -QGFDNRAMAMKQQYLIHQQTQQSHPAQQRYNYAQQHAQHYAPQPQLQPQPQPQPQYPQH 232
             ....|...|......:.||||            ||..|....|.|.|.|.|.|.|..||
  Fly   128 CNSNSNGNSASNSLIRLQQQTQ------------QQMQQQLQQQLQQQLQQQMQQQQQQH 175



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29BUM
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.