DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp7Fc and C01C4.2

DIOPT Version :9

Sequence 1:NP_572485.1 Gene:Cp7Fc / 31786 FlyBaseID:FBgn0014466 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001359815.1 Gene:C01C4.2 / 182065 WormBaseID:WBGene00015292 Length:453 Species:Caenorhabditis elegans


Alignment Length:154 Identity:32/154 - (20%)
Similarity:55/154 - (35%) Gaps:39/154 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 DNRAMAMKQQYLIHQQTQ-QSHPAQQRYNYAQQHAQHYAPQPQL--QPQPQP--QPQYP------ 230
            :..|.|.|:: |:.:.|. |:.|.....|..::..:.....|..  .|...|  .|.||      
 Worm   270 EEEARAAKEK-LVKKSTHVQTEPTDTLRNIRKKLPRTLPSTPNTIRSPSTPPIFYPTYPSPNSII 333

  Fly   231 ----QH-----TPHRNTYAMPQNYGQQ----NYKPQSYIINSSEDQLHAEQSNPSPMKSAGEDRQ 282
                :|     |...|...:..|..|.    :|.|:|..:..:| ::..:|....|::       
 Worm   334 GTIIEHKSEIVTVGNNYLLVLDNRNQAANVLSYTPRSEALQKAE-KIFNDQMPSLPVE------- 390

  Fly   283 HHEEEFDSFGGQLNFKSPFNDYGS 306
             |::....|.     :||.|.|.|
 Worm   391 -HKDIPQVFS-----RSPSNLYNS 408



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29BUM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.