DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32110 and Senp3

DIOPT Version :9

Sequence 1:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001157043.1 Gene:Senp3 / 80886 MGIID:2158736 Length:568 Species:Mus musculus


Alignment Length:275 Identity:80/275 - (29%)
Similarity:141/275 - (51%) Gaps:29/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LNEAHQLCLKAKHERIACEIDRYKKLI---LKQSVHVIEDIRISSELIPLTKEHHDRLMELSKYP 204
            |.|.|..|:::..:..   :..|..||   ..:.|..:|||.......|..|....:|::..:..
Mouse   303 LREEHVTCVQSILDEF---LQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKSLVLQLIQSYQRM 364

  Fly   205 LQQVIVAKFNLD-----ICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVP-SVYAMSTF 263
            ....:|..|.:.     :...|:..|....||||:::|.|.:|:::       ||| .|:..::|
Mouse   365 PGNAMVRGFRVSYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMD-------TVPEKVHFFNSF 422

  Fly   264 FVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLM 328
            |..:|...|:|||||||:.||:|:.:|:|:|:| :.|||.|:.:|:..:|:.|::|:...:....
Mouse   423 FYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIH-LEVHWSLISVDVRRRTITYFDSQRTLNRRCP 486

  Fly   329 RALVKYLQMESEDKLGLCLDTSEF----RIEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFS 389
            :.:.||||.|:..|     |..:|    :.....||.:|:|.:|||.||..:.::|....|.:|:
Mouse   487 KHIAKYLQAEAVKK-----DRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFT 546

  Fly   390 KKDMKYFRTKMVLEL 404
            ::||...|.::..||
Mouse   547 QQDMPKLRRQIYKEL 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 60/174 (34%)
Senp3NP_001157043.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119
Nuclear localization signal. /evidence=ECO:0000255 119..122
Nuclear localization signal. /evidence=ECO:0000255 147..153
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..174
Protease 380..537 56/169 (33%)
Peptidase_C48 394..566 CDD:280975 62/181 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836056
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12606
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.