DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32110 and si:dkey-100n23.3

DIOPT Version :9

Sequence 1:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_005167827.1 Gene:si:dkey-100n23.3 / 571373 ZFINID:ZDB-GENE-070912-345 Length:991 Species:Danio rerio


Alignment Length:287 Identity:68/287 - (23%)
Similarity:105/287 - (36%) Gaps:106/287 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 RLMELSKYPLQQVIVAKFNLDICGSDIKILTSGGWLNDKIINFYMN-LLVERSEKRPGTVPSVYA 259
            ||::....|      :|..|.:...|::.|.||.:|||.||:||:. |||:::.:  .:|...:.
Zfish   664 RLIQFPPPP------SKGALTVTTEDLECLDSGEFLNDVIIDFYLKYLLVQKAPQ--ASVARSHI 720

  Fly   260 MSTFFVPRLLQSG---------------FDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDL 309
            .|:||..:|.:..               ...|:.|||.||:|..|.:.|||:|. .||.||:|..
Zfish   721 FSSFFYKQLTRRDNANEDSTSTPAQVRRHQRVRTWTRHVDIFEKDFLFVPVNQE-AHWYLVVICF 784

  Fly   310 PAKTMLYYNSRG--------------------RGD------------------------------ 324
            |......|..|.                    :||                              
Zfish   785 PGLEDPQYVKRDDSASVQGNGGEDVGESENETQGDHRSNSDEDKSTDDSRIKSSTSLRQPDCTEN 849

  Fly   325 ------------------------PNLMRALVKYLQMESEDKLGLCLDTSEFRIE----DAQNVP 361
                                    ..:.:.|.:|||:|.|.|.   :.|.:|..|    ....||
Zfish   850 TCKKDVVLKRPCILIMDSLKLSIHERIFKLLREYLQVEWETKR---MGTRDFSAERMVGSHCKVP 911

  Fly   362 QQDNMNDCGVFVCMFAEYLTRDAPITF 388
            .|||.:|||:::..:||...:|..:.|
Zfish   912 LQDNSSDCGLYLLQYAESFLQDPVVHF 938

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 59/253 (23%)
si:dkey-100n23.3XP_005167827.1 ULP1 <678..939 CDD:227489 63/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.