DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32110 and ulp-3

DIOPT Version :9

Sequence 1:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001023477.1 Gene:ulp-3 / 3565434 WormBaseID:WBGene00006738 Length:210 Species:Caenorhabditis elegans


Alignment Length:237 Identity:59/237 - (24%)
Similarity:86/237 - (36%) Gaps:87/237 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 DIRISSELIPLTKEHHDRLMELSKYPLQQVIVAKFNLDICGSDIKILT-SGGWLNDKIINFYMNL 242
            |.|:|.|.:.||.:                            |:.||. :|.|.|||::.|....
 Worm     6 DFRLSYESVVLTAD----------------------------DVTILEHTGCWFNDKLLTFCAEF 42

  Fly   243 LVERSEKRPGTVPSVYAMSTFFVP----RLLQSGFDGVKRWTRKVDLF-------SMDLI--LVP 294
            |.:.:        |..|....|.|    .:..|..|      .:||::       |.|||  :|.
 Worm    43 LEQHN--------SAAAEIQIFTPPQTEMIRHSTCD------EEVDMYFGCLDVNSKDLIAFIVN 93

  Fly   295 VHQMLV------HWCLVIIDLPAKTMLYYNS-RGRG---DPNLM---RALVKYLQMESEDKLGLC 346
            .:|.:.      ||.|:|.|.......:::| ||..   ..|||   |.||:..|.:...:..||
 Worm    94 DNQDVTRVNGGSHWSLLIFDRKIDKFRHFDSARGHNLKIAENLMQKSRKLVRQRQSQRNLEPELC 158

  Fly   347 LDTSEFRIEDAQNVPQQDNMNDCGVFVCMF----AEYLTRDA 384
            |              ||.|.:|||:.|..:    ||..:.||
 Worm   159 L--------------QQKNASDCGLHVAQYLAVLAEQKSADA 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 49/185 (26%)
ulp-3NP_001023477.1 ULP1 <12..171 CDD:227489 51/214 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.