DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32110 and Senp3

DIOPT Version :9

Sequence 1:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001013134.2 Gene:Senp3 / 303245 RGDID:1312040 Length:568 Species:Rattus norvegicus


Alignment Length:275 Identity:81/275 - (29%)
Similarity:141/275 - (51%) Gaps:29/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LNEAHQLCLKAKHERIACEIDRYKKLI---LKQSVHVIEDIRISSELIPLTKEHHDRLMELSKYP 204
            |.|.|..|:::..:..   :..|..||   ..:.|..:|||.......|..|....:|::..:..
  Rat   303 LREEHVTCVQSILDEF---LQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKSLVLQLIQSYQRM 364

  Fly   205 LQQVIVAKFNLD-----ICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVP-SVYAMSTF 263
            ....:|..|.:.     :...|:..|....||||:::|.|.:|:::       ||| .|:..::|
  Rat   365 PGNAMVRGFRVSYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMD-------TVPEKVHFFNSF 422

  Fly   264 FVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLM 328
            |..:|...|:|||||||:.||:|:.:|:|:|:| :.|||.||.:|:..:|:.|::|:...:....
  Rat   423 FYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIH-LEVHWSLVSVDVRRRTITYFDSQRTLNRRCP 486

  Fly   329 RALVKYLQMESEDKLGLCLDTSEF----RIEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFS 389
            :.:.||||.|:..|     |..:|    :.....||.:|:|.:|||.||..:.::|....|.:|:
  Rat   487 KHIAKYLQAEAVKK-----DRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFT 546

  Fly   390 KKDMKYFRTKMVLEL 404
            ::||...|.::..||
  Rat   547 QQDMPKLRRQIYKEL 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 61/174 (35%)
Senp3NP_001013134.2 Peptidase_C48 394..566 CDD:280975 63/181 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339711
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12606
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.