DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32110 and SENP3

DIOPT Version :9

Sequence 1:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_056485.2 Gene:SENP3 / 26168 HGNCID:17862 Length:574 Species:Homo sapiens


Alignment Length:275 Identity:80/275 - (29%)
Similarity:141/275 - (51%) Gaps:29/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LNEAHQLCLKAKHERIACEIDRYKKLI---LKQSVHVIEDIRISSELIPLTKEHHDRLMELSKYP 204
            |.|.|..|:::..:..   :..|..||   ..:.|..:|||.......|..|....:|::..:..
Human   309 LREEHVTCVQSILDEF---LQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRM 370

  Fly   205 LQQVIVAKFNLD-----ICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVP-SVYAMSTF 263
            ....:|..|.:.     :...|:..|....||||:::|.|.:|:::       ||| .|:..::|
Human   371 PGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMD-------TVPEKVHFFNSF 428

  Fly   264 FVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLM 328
            |..:|...|:|||||||:.||:|:.:|:|:|:| :.|||.|:.:|:..:|:.|::|:...:....
Human   429 FYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIH-LEVHWSLISVDVRRRTITYFDSQRTLNRRCP 492

  Fly   329 RALVKYLQMESEDKLGLCLDTSEF----RIEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFS 389
            :.:.||||.|:..|     |..:|    :.....||.:|:|.:|||.||..:.::|....|.:|:
Human   493 KHIAKYLQAEAVKK-----DRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFT 552

  Fly   390 KKDMKYFRTKMVLEL 404
            ::||...|.::..||
Human   553 QQDMPKLRRQIYKEL 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 60/174 (34%)
SENP3NP_056485.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..125
Nuclear localization signal. /evidence=ECO:0000255 125..128
Nuclear localization signal. /evidence=ECO:0000255 153..159
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..181
Protease 386..543 56/169 (33%)
Peptidase_C48 400..572 CDD:280975 62/181 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145972
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12606
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.