DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32110 and Senp6

DIOPT Version :9

Sequence 1:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001298039.1 Gene:Senp6 / 215351 MGIID:1922075 Length:1139 Species:Mus musculus


Alignment Length:337 Identity:75/337 - (22%)
Similarity:127/337 - (37%) Gaps:111/337 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LQAIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQKNKLNR-KRLNEAHQLCLKAKHERIACEI 162
            |||||||:         :.|.::....::.:.|.|.|. :|| ..|.|.:.:.:      ....:
Mouse   534 LQAIPAVY---------QKLSMQLQMSKEDKVWNDCKG-INRITSLEEQYIILI------FQTGL 582

  Fly   163 DRYKKLILKQSVHVIEDIRI----------------SSELIPLTKEHHDRL-------------- 197
            |...:::.:.   :|.||.|                :|.|:..|:.:.:.:              
Mouse   583 DHQAEVVFES---IITDIGIRNNVPNFFAKILFDEANSRLVACTRSYEESIKGNCAQKENKVKTV 644

  Fly   198 -----------MELSKY---------------PLQQVIV-----AKFNLDICGSDIKILTSGGWL 231
                       .||..:               |::::||     ||..:.:...|:..|:.|.:|
Mouse   645 SFESKIQLRSKQELQFFDDDEEAGESHTIFIGPVEKLIVYPPPPAKGGISVTNEDLHCLSEGEFL 709

  Fly   232 NDKIINFYMNLLV-ERSEKRPGTVPSVYAMSTFFVPRL--------------LQSGFDG-VKRWT 280
            ||.||:||:..|| |:.:|.  ....::..|:||..||              :|....| ||.||
Mouse   710 NDVIIDFYLKYLVLEKLKKE--DADRIHIFSSFFYKRLNQRERRNPETTNLSIQQKRHGRVKTWT 772

  Fly   281 RKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMESED---- 341
            |.||:|..|.|.||::: ..||.|.::..|......|..    :|:.....|......:||    
Mouse   773 RHVDIFEKDFIFVPLNE-AAHWFLAVVCFPGLEKPKYEP----NPHYHENAVMQKTPSAEDSCVS 832

  Fly   342 ---KLGLCLDTS 350
               ::|.|...|
Mouse   833 SASEMGACSQNS 844

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 42/144 (29%)
Senp6NP_001298039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..51
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..395
Protease 693..1139 45/159 (28%)
Peptidase_C48 707..>819 CDD:304959 36/118 (31%)
Peptidase_C48 <999..1075 CDD:304959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.