Sequence 1: | NP_729837.1 | Gene: | CG32110 / 317858 | FlyBaseID: | FBgn0052110 | Length: | 411 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001298039.1 | Gene: | Senp6 / 215351 | MGIID: | 1922075 | Length: | 1139 | Species: | Mus musculus |
Alignment Length: | 337 | Identity: | 75/337 - (22%) |
---|---|---|---|
Similarity: | 127/337 - (37%) | Gaps: | 111/337 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 LQAIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQKNKLNR-KRLNEAHQLCLKAKHERIACEI 162
Fly 163 DRYKKLILKQSVHVIEDIRI----------------SSELIPLTKEHHDRL-------------- 197
Fly 198 -----------MELSKY---------------PLQQVIV-----AKFNLDICGSDIKILTSGGWL 231
Fly 232 NDKIINFYMNLLV-ERSEKRPGTVPSVYAMSTFFVPRL--------------LQSGFDG-VKRWT 280
Fly 281 RKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMESED---- 341
Fly 342 ---KLGLCLDTS 350 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32110 | NP_729837.1 | Peptidase_C48 | 230..400 | CDD:280975 | 42/144 (29%) |
Senp6 | NP_001298039.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 23..51 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 334..395 | ||||
Protease | 693..1139 | 45/159 (28%) | |||
Peptidase_C48 | 707..>819 | CDD:304959 | 36/118 (31%) | ||
Peptidase_C48 | <999..1075 | CDD:304959 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5160 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |