DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32110 and SENP5

DIOPT Version :9

Sequence 1:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_689912.2 Gene:SENP5 / 205564 HGNCID:28407 Length:755 Species:Homo sapiens


Alignment Length:298 Identity:90/298 - (30%)
Similarity:149/298 - (50%) Gaps:55/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EAHQLC--LK-------AKHERIACEIDRYKKLILKQSVHVIEDIRISSELIPLT-KEHHDRL-- 197
            ||..:|  ||       .|:.:.|..:|. ::|.:..|..:.|.::....|:||: ||...||  
Human   468 EAPLVCSGLKLENQVGGGKNSQKASPVDD-EQLSVCLSGFLDEVMKKYGSLVPLSEKEVLGRLKD 531

  Fly   198 --------------MELSKYPLQ------QVIVAKFNLDICGSDIKILTSGGWLNDKIINFYMNL 242
                          .|::.|..:      ::...|..||:  .|:..|....||||::||.|..|
Human   532 VFNEDFSNRKPFINREITNYRARHQKCNFRIFYNKHMLDM--DDLATLDGQNWLNDQVINMYGEL 594

  Fly   243 LVERSEKRPGTVP-SVYAMSTFFVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVI 306
            :::       .|| .|:..::||..:|:..|::||||||:|||||...|:|:|:| :.|||.|:.
Human   595 IMD-------AVPDKVHFFNSFFHRQLVTKGYNGVKRWTKKVDLFKKSLLLIPIH-LEVHWSLIT 651

  Fly   307 IDLPAKTMLYYNSRGRGDPNLMRALVKYLQMESEDKLGLCLDTSEFRIEDAQN-----VPQQDNM 366
            :.|..:.:.:|:|:|......:..:.|||..|:.:|     :..|| ::..|.     :|||.|.
Human   652 VTLSNRIISFYDSQGIHFKFCVENIRKYLLTEAREK-----NRPEF-LQGWQTAVTKCIPQQKND 710

  Fly   367 NDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLEL 404
            :||||||..:.:.|..:.|..||::||...|.::..||
Human   711 SDCGVFVLQYCKCLALEQPFQFSQEDMPRVRKRIYKEL 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 63/175 (36%)
SENP5NP_689912.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..321
Protease 567..724 60/172 (35%)
Peptidase_C48 581..753 CDD:280975 65/182 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145976
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12606
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.