DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32110 and ulp-5

DIOPT Version :9

Sequence 1:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_491952.1 Gene:ulp-5 / 186900 WormBaseID:WBGene00006740 Length:311 Species:Caenorhabditis elegans


Alignment Length:273 Identity:61/273 - (22%)
Similarity:95/273 - (34%) Gaps:92/273 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 HDRLMELSKYPLQQVIVAKFNLDICGSD----IKILTSGGW---------LNDKIINFYMNLLVE 245
            |.:|....:.|.::.:.   :|:|...|    |..|...||         |||.||.|||...:.
 Worm     3 HPKLTPKCEAPPEKRLA---HLEIRFKDRRHIIPPLFHNGWVGRNEDRTLLNDTIIEFYMCDWMR 64

  Fly   246 RSEKRPGTVPSVYAMSTFFVPRLLQSGFDGVKRWTRKVDL-----------------FSMDLILV 293
            .......|..|.:...:||:|::.....|..:...|:.:|                 ...|::|:
 Worm    65 LEVFDEATRASSHVFHSFFLPKIKTCFKDFKENPPRRSELANHYNRFFRSKNDAETFLKKDILLI 129

  Fly   294 PVH-QMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYL----------QMESEDKLGLC- 346
            ||| ....||.|||:..|:..:     |...|.|::.|..|..          .:..::..|.| 
 Worm   130 PVHLDKPKHWFLVIVHNPSGAV-----RRISDVNILDATNKVKSRRLSRRITGHVNCDENAGECR 189

  Fly   347 ---LDT---------------------------------------SEFRIEDAQNVPQQDNMNDC 369
               :|:                                       :.||....|.:|||.|..||
 Worm   190 IIIMDSLVHSKKYREVIDKTHDSTFDHIRLWLLMSAAATDVDMFCTRFRKVVCQKLPQQKNSVDC 254

  Fly   370 GVFVCMFAEYLTR 382
            |:|:..||||.|:
 Worm   255 GIFMMAFAEYFTK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 52/233 (22%)
ulp-5NP_491952.1 Peptidase_C48 50..302 CDD:367240 51/223 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.