DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32110 and senp6

DIOPT Version :9

Sequence 1:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_031757351.1 Gene:senp6 / 100135175 XenbaseID:XB-GENE-962887 Length:1193 Species:Xenopus tropicalis


Alignment Length:128 Identity:43/128 - (33%)
Similarity:61/128 - (47%) Gaps:24/128 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 PLQQVIV-----AKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTF 263
            |::::.|     ||..:.:...|:..|..|.:|||.||:||:..||  .||.......::..|:|
 Frog   744 PVEKLFVYPPPPAKGGISVTNEDLHCLNEGEFLNDVIIDFYLKYLV--LEKLRKDADRIHIFSSF 806

  Fly   264 FVPRL---------------LQSGFDG-VKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLP 310
            |..||               ||....| ||.|||.||:|..|.|.||::: ..||.|.:|..|
 Frog   807 FYKRLNQRERRNLQDTANLTLQQRRHGRVKTWTRHVDIFQKDFIFVPLNE-AAHWFLAVICFP 868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 36/97 (37%)
senp6XP_031757351.1 ULP1 <757..868 CDD:227489 39/113 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.