DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32110 and senp7b

DIOPT Version :9

Sequence 1:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_005161832.1 Gene:senp7b / 100006377 ZFINID:ZDB-GENE-060531-45 Length:884 Species:Danio rerio


Alignment Length:279 Identity:65/279 - (23%)
Similarity:108/279 - (38%) Gaps:96/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LSKYPLQQVIVAKFNLDICGSDIKILTSGGWLNDKIINFYMN-LLVERSEKRPGTVPSVYAMSTF 263
            |.:||...   :|..:.:...|::.|..|.:|||.||:||:. ||:||::|  ......:..|:|
Zfish   575 LIQYPPPP---SKGGITVTTEDLECLKDGEFLNDVIIDFYLKYLLLERADK--DIAERSHIFSSF 634

  Fly   264 FVPRLLQSGFDG---------------VKRWTRKVDLFSMDLILVPV-HQMLVHWCLVIIDLPA- 311
            |..:|.:....|               |:.|||.||:||.|.:.:|| |:  .||.||:|..|| 
Zfish   635 FYKQLTRKDTSGPEETGSTSAYRRHQRVRTWTRHVDIFSKDYLFIPVNHE--AHWYLVLICFPAL 697

  Fly   312 ----------------------------KTMLYYNSRGRGDPNLMR------------------- 329
                                        ::....:.:.:|:|:.:.                   
Zfish   698 ERPQIVEWRQKSSVSQDESQTTKERPSGESQRESSQQPKGNPSKINESRSHNLPDCTVHSCTKET 762

  Fly   330 -----------------------ALVKYLQMESEDKLGLCLDTSEFRIEDAQ-NVPQQDNMNDCG 370
                                   .|.:|||:|.|.:.|.|...|...|..:. .||.|||.:|||
Zfish   763 ICKRPCILIMDSLKLSYHQRTYTLLREYLQVEWEVRKGSCRSFSNESITGSLCRVPLQDNSSDCG 827

  Fly   371 VFVCMFAEYLTRDAPITFS 389
            :::..:.|...::..:.|:
Zfish   828 LYLLQYVESFLQNPVVDFA 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 58/249 (23%)
senp7bXP_005161832.1 Peptidase_C48 601..845 CDD:304959 57/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.